KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1112Help
Entry
HI1112            CDS       T00001                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:hin00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hin00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1177909..1179228
Genome map
AA seq 439 aa AA seqDB search
MTTYFDKIEKISFEGEKSTNPFAFKHYDANQVILGKTMAEHLRLAVCYWHTFCWNGNDMF
GLGSLERSWQKNSNLLAGAEQKADIAFEFLNKLGVPYYCFHDVDIAPEGNSVREYVQNFH
HIVDILERKQVETGVKLLWGTANCFTNPRYMSGAATNPNPEVFAWAATQVFNAMNATQRL
GGENYVLWGGREGYETLLNTDLKREREQIGRFMQMVVEHKHKIGFKGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHTFQHEIATACALDIFGSIDANRG
DPQLGWDTDQFPNSVEENTLVMYEILKHGGFTTGGFNFDAKIRRQSIDPYDLFYAHIGAI
DVLALSLKRAAKMLQEETLQKIVNERYAGWNSELGQHILQGKTSLETLAQLVQQKDLAPK
PVSGQQEYLENLVNQVIYS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctatttcgataaaattgaaaaaatctcctttgagggagaaaaatccacaaat
ccttttgctttcaaacattatgatgctaatcaagtaattttaggtaaaactatggctgaa
catttacgcttagcggtgtgttattggcataccttttgctggaatgggaatgatatgttt
gggctaggttctttggaacgaagttggcagaaaaattcaaatttgcttgctggcgcagaa
caaaaagccgatattgcttttgagtttttgaataagttaggcgtgccttattattgtttt
catgatgtcgatattgcacctgaaggtaattcagtgcgggaatatgtacaaaattttcat
catattgttgatattttagaacgcaaacaagtagaaacgggtgtaaaactcttatgggga
actgcaaattgttttactaatcctcgttatatgtctggtgcagcaaccaatcctaatcct
gaggtttttgcttgggctgcaacacaagtgtttaatgcgatgaatgccactcaacgttta
ggtggagaaaattacgtattatggggtggacgtgagggatatgaaactttattgaatacc
gatttgaaacgtgaacgtgaacaaattggtcgttttatgcaaatggtggtagaacataag
cataaaattgggtttaaaggtacattattaattgagccaaaaccgcaagaaccaactaaa
catcaatatgattatgatgtggcaacagtgtatggtttcctaaaacaatttggtttagaa
aaagaaattaaagttaatattgaagctaaccacgcgacgcttgctggccatacctttcaa
catgaaattgcaacagcttgtgcattagatatttttggctcaattgatgctaatcgtggc
gatccacaattaggctgggataccgaccaattcccaaatagtgttgaagaaaacacgtta
gttatgtatgaaattttaaaacatggtggttttactactggaggttttaattttgatgcg
aaaattcgccgacaaagtattgatccttatgatttattttacgctcatatcggtgcaatt
gatgtattggcattatccttaaaacgtgcagcaaaaatgttacaagaggaaaccttacaa
aaaattgttaatgaacgctatgcaggttggaatagtgaacttggtcagcatattttgcaa
ggcaaaacttcacttgaaacacttgcgcaacttgtccaacaaaaagatttagcaccaaaa
ccagtttcaggtcagcaagaatatttggaaaatttggtaaaccaagttatttatagctaa

DBGET integrated database retrieval system