KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1196Help
Entry
HI1196            CDS       T00001                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00020  Citrate cycle (TCA cycle)
hin00640  Propanoate metabolism
hin00660  C5-Branched dibasic acid metabolism
hin01100  Metabolic pathways
hin01110  Biosynthesis of secondary metabolites
hin01120  Microbial metabolism in diverse environments
hin01130  Biosynthesis of antibiotics
hin01200  Carbon metabolism
Module
hin_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HI1196 (sucC)
   00640 Propanoate metabolism
    HI1196 (sucC)
   00660 C5-Branched dibasic acid metabolism
    HI1196 (sucC)
Enzymes [BR:hin01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HI1196 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 950149
NCBI-ProteinID: NP_439352
UniProt: P45101
Position
1262121..1263290
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKQLFEHYGLPVKNGAVCQSVEDVDLVLAQLSGGKWAAKCQVHAGGRGKAGGV
KLVQDVEEARAFAEKWLGQRLVTFQTDKLGQPVNQIYFEETCDIDKEFYLSAVVDRTSQK
VVFIASSEGGMNIEEVVQNSPHLLHKVTIDPLFGGLPYQGRELAFKLGLSGTQNKQFTDI
FMGLSRLFLEKDLSLLEVNPLVLTPQGNLVCLDAKISVDDNALFRHKDLLALQDLTQNDA
REAEAEKFQLNYVALEGDIGCMVNGAGLAMGTMDIVKLYGGKPANFLDVGGGATQERVAE
AFKIILTDPSVKVILVNIFGGIVRCDLIAEGVIAAVNEVGVRVPVVVRLEGTNAEMGRQI
LAESDVNILTAQSLQQAAELAVNAAKGEH
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaataccaagcaaaacaactatttgagcattatggattacccgtaaaa
aatggggcagtctgtcaatctgttgaggatgtcgatttggtactggctcaactttcaggc
ggtaagtgggcagcgaaatgccaagttcatgctggtgggcgtggtaaagcgggtggcgtt
aaattggtacaggatgtagaggaagcgagagcttttgcagaaaaatggctgggacaacgt
ttagtcacttttcaaacggataaattgggtcagccagtaaaccagatttattttgaagaa
acttgcgatattgataaagaattttacttaagtgcggttgttgatcgcacctctcaaaaa
gtggtgtttattgcttcctctgagggtggaatgaatattgaagaagtcgtgcaaaattca
ccgcacttactccataaagtaaccattgatcctttatttggaggattgccttatcaaggc
cgtgaattggcgtttaaattagggttaagtggtacgcaaaacaaacagtttaccgatatc
tttatgggcttatctcgtttgtttttagaaaaagatttatctttactggaagtcaatccg
cttgttctcactccacaaggcaatttggtttgtctcgatgccaaaatatctgtcgatgat
aacgctttatttcgccataaagatttattagcactgcaagatttaactcaaaatgatgcc
cgtgaagcagaagctgaaaaattccagttaaactatgtggctttagagggcgatattggt
tgtatggtaaacggggctgggcttgcaatgggcaccatggatattgtgaaactctatggt
gggaagcctgcgaattttcttgatgtgggtggtggtgcaacgcaagagcgggttgctgaa
gcgttcaaaatcattttaaccgatccttccgttaaagtgattttagtgaatatttttggt
ggcattgttcgttgtgatttgattgctgaaggtgtgattgctgcagtaaatgaagtgggc
gtgagagtgcctgtggttgtgcgattagaaggaacgaatgctgaaatgggtcgccaaatt
ttagcggaaagcgacgttaatattcttaccgcacagagtttacaacaagccgcagaatta
gccgtgaatgcagcaaaaggagaacactaa

DBGET integrated database retrieval system