KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1213Help
Entry
HI1213            CDS       T00001                                 

Gene name
dsbC
Definition
thiol-disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Brite
Enzymes [BR:hin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HI1213 (dsbC)
Secretion system [BR:hin02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HI1213 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1280420..1281109
Genome map
AA seq 229 aa AA seqDB search
MKKIFTALLCVAAANAMADDAAIKRKLQSFNISNIVIKSSPISGIKTAVTDQGILYVSED
GKYLFEGKLYELTNNGPVDVAGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDITCHYCH
LLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTAKDPVFALNEAEKGNLPKEVK
TPNIVKKHYELGIQFGVRGTPSIVTSTGELIGGYLKPADLLRALEETAQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatttttaccgcacttttgtgcgtggctgcggctaatgcaatggcagatgat
gcggcaattaaacgcaaattacagtcttttaatatatcaaatattgttattaaatcttcg
ccgatttcaggcattaaaacggctgttacggatcaaggtatactctatgtgagcgaagat
ggaaaatatctttttgaaggtaaactttatgaactcacaaataatggccctgttgatgtc
gcaggtaaaattttagtggataaacttaattcttataaagacgagatgattgtttatcct
gcgaaaaatgaaaaacacgtagtaacagtatttatggatattacctgtcattattgccat
ttgttacatcagcaattaaaagaatataatgatcttggcattaccgtacgttatttagct
ttccctcgtgcaggtatgaataatcaaacggcgaaacaaatggaagcgatttggacggcg
aaagatcccgtttttgctttaaatgaagcagaaaaaggcaatttaccaaaagaagttaaa
acgccaaatatcgtgaaaaaacattatgaattaggtattcaatttggtgtacgaggaaca
ccaagtattgttacctcaactggtgagcttattggcggttatttaaaacccgctgattta
ttaagagcacttgaagaaacggcacaataa

DBGET integrated database retrieval system