KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1232Help
Entry
HI1232            CDS       T00001                                 

Gene name
aceF
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00010  Glycolysis / Gluconeogenesis
hin00020  Citrate cycle (TCA cycle)
hin00620  Pyruvate metabolism
hin01100  Metabolic pathways
hin01110  Biosynthesis of secondary metabolites
hin01120  Microbial metabolism in diverse environments
hin01130  Biosynthesis of antibiotics
hin01200  Carbon metabolism
Module
hin_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HI1232 (aceF)
   00020 Citrate cycle (TCA cycle)
    HI1232 (aceF)
   00620 Pyruvate metabolism
    HI1232 (aceF)
Enzymes [BR:hin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HI1232 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 DUF935
Motif
Other DBs
NCBI-GeneID: 949836
NCBI-ProteinID: NP_439388
UniProt: P45118
Position
complement(1302097..1303800)
Genome map
AA seq 567 aa AA seqDB search
MSKQIQIPDIGSDEVTVTEVMVNVGDTISVDQSIINVEGDKASMEVPAPEAGVVKEILVK
VGDKVSTGTPMLVLEAAGAAPAADEPTAPVADAPTAPVVATAPTASAIVEVNVPDIGGDE
VNVTEIMVAVGDTITEEQSLITVEGDKASMEVPAPFGGVVKEILVKSGDKVSTGSLIMRF
EVLGAAPAESASAPASTSAPQTAAPATTAQAPQAAAPDTTAQAPQAAAPDTTAQAAQSNN
NVSGLSQEQVEASTGYAHATPVIRRLAREFGVNLDKVKGTGRKGRIVKEDIEAYVKTAVK
AYESGATAQATGNGVANGAGLGLLPWPKVDFSKFGEIEEVELSRINKISGANLHRNWVII
PHVTHFDKADITDLEAFRKEQNALREKQKLGVKITPVVFIMKAVAKALEAYPRFNSSITE
DAQRLILKKYINIGVAVDTPNGLVVPVFKNVNKKGIIELSRELMEVSKKAREGKLTASDM
QGGCFTISSLGGIGTTHFAPIVNAPEVAILGVSKSSMEPVWNGKEFAPRLILPMSLSFDH
RVIDGADGARFISYLGSVLADLRRLVM
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattcaaattcctgatattggtagtgatgaagttaccgtaacagaagtc
atggtaaacgtaggcgataccatttctgttgatcaatctatcattaacgttgaaggcgat
aaagcttcaatggaagtgcctgcaccagaagcgggtgttgtaaaagaaattttagtcaaa
gtgggcgataaagtttcaactggtactccaatgcttgtattagaagcggcaggtgctgct
ccagcagctgatgagcctactgctccagtagctgatgcgcctactgcaccagtggttgct
accgcaccaacggcttcagctattgtagaagtaaatgtgccagatattggtggcgatgaa
gtcaatgtaaccgaaattatggttgcagttggcgatacaatcactgaagaacaatcttta
attaccgttgaaggcgataaagcctcaatggaagttcctgcaccattcggcggtgtggta
aaagaaattttagtgaaatcaggcgataaagtttcaactggttcattaattatgcgtttt
gaagtactaggtgcagctccagcagaatcagcatcagctccagcttcaacatcagcacca
cagacagcagctcctgctactactgcacaagcaccacaggcagcagctcctgatactact
gcacaagcaccacaggcagcagctcctgatactactgcacaagcagctcaatcaaataac
aacgtatctggattaagccaagaacaagtagaagcaagtacaggatatgcacacgcaaca
ccagtaattcgtcgtttagctcgtgaatttggtgtaaatctagataaagtaaaaggtact
ggtcgtaaaggtcgtatcgttaaagaagatattgaagcttatgtgaagaccgcagttaaa
gcctatgaaagcggtgcaacagcacaagctactggcaatggtgtagcaaatggtgctggc
ttaggcttattgccatggccaaaagttgatttcagtaaatttggcgaaattgaagaagtt
gaattaagtcgtatcaacaaaatttcaggtgctaacttacatcgtaactgggtaataatt
ccacacgtcactcacttcgataaagcagatatcacggatttagaagcattccgtaaagaa
caaaatgcgttacgagaaaaacaaaaactcggtgtaaaaatcacgccagttgtgtttatt
atgaaagcggtggcaaaagcattagaagcgtatccacgtttcaacagctcaattaccgaa
gatgctcaacgcttaatcctgaaaaaatatattaacatcggtgtcgcagtagatacgccg
aatggcttagtcgtgcctgtattcaaaaatgtgaacaagaaaggcattatcgaactttca
cgtgaattaatggaagtatcgaaaaaagcccgtgaaggcaaattgactgcatctgatatg
caaggtggctgtttcaccatttcaagtcttggtggtattggtacaacgcactttgcacca
atcgtaaatgcgccagaagtagctatccttggtgtgtctaaatcatcaatggaaccagta
tggaatggtaaagaatttgcgccacgcttaattcttccaatgtcattatcattcgaccac
cgtgtcattgatggtgcagatggagctcgtttcattagctatcttggctctgttttagca
gatttacgtcgcttagtaatgtaa

DBGET integrated database retrieval system