KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1317Help
Entry
HI1317            CDS       T00001                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hin00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1394078..1394893
Genome map
AA seq 271 aa AA seqDB search
MKTTLLKTLTPELHLVQHNDIPVPSLKTCGWNTKNFPCKGHSLSVGXPQNAKQDVLWLSE
VEPFKNGNAIRGGVPICYPWFGGVKQPAHGTARIRLWQLSHYYISVHKVRLEFELFSDLN
IIEAKVSMVFTDKCHLTFTHYGEESAQAALHTYFNIGDINQVEVQGLPETCFNSLNQQQE
NVPSPRHISENVDCIYSAENMQNQILDKSFNRTIALHHHNASQFVLWNPWHKKTSGMSET
GYQKMLCLETARIHHLLEFGESLSVEISLKG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacattactaaaaacactgacaccagagcttcatcttgttcaacataacgac
attccagttccttcacttaaaacatgcggttggaacaccaaaaatttcccctgcaagggg
cacagcttatcagttggaancccccaaaatgcgaagcaagatgtattatggctaagtgaa
gtagagccattcaaaaatggcaatgctattcgtggtggtgtaccgatttgttatccttgg
tttggtggcgtaaaacaacctgcgcacggtacagctcgtattcgtttatggcagttgagt
cattactatatttcagtgcataaagtgcggttagaatttgagttgttttctgatttaaat
attatcgaagctaaagtctcaatggtatttacagataaatgtcatttaacttttacccat
tatggcgaagaatcagcccaagcagcattacatacctattttaatattggggatattaat
caagtggaagtacaaggtttacctgaaacttgttttaatagcttaaaccaacaacaagaa
aatgttccgtcaccgcgtcacatttctgaaaatgttgattgcatttattctgcagaaaac
atgcagaatcaaatcctagataaaagtttcaatcgtacaattgcactgcatcatcataat
gcaagccaatttgttctttggaatccttggcacaaaaagacgagtggaatgagtgaaact
ggctatcaaaagatgttgtgcttagaaactgcacgtatccatcacttgcttgaatttggc
gaaagtttaagcgtagaaatttcgcttaaaggctaa

DBGET integrated database retrieval system