KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1317Help
Entry
HI1317            CDS       T00001                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HI1317
Enzymes [BR:hin01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     HI1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1394078..1394893
Genome map
AA seq 271 aa AA seqDB search
MKTTLLKTLTPELHLVQHNDIPVPSLKTCGWNTKNFPCKGHSLSVGXPQNAKQDVLWLSE
VEPFKNGNAIRGGVPICYPWFGGVKQPAHGTARIRLWQLSHYYISVHKVRLEFELFSDLN
IIEAKVSMVFTDKCHLTFTHYGEESAQAALHTYFNIGDINQVEVQGLPETCFNSLNQQQE
NVPSPRHISENVDCIYSAENMQNQILDKSFNRTIALHHHNASQFVLWNPWHKKTSGMSET
GYQKMLCLETARIHHLLEFGESLSVEISLKG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacattactaaaaacactgacaccagagcttcatcttgttcaacataacgac
attccagttccttcacttaaaacatgcggttggaacaccaaaaatttcccctgcaagggg
cacagcttatcagttggaancccccaaaatgcgaagcaagatgtattatggctaagtgaa
gtagagccattcaaaaatggcaatgctattcgtggtggtgtaccgatttgttatccttgg
tttggtggcgtaaaacaacctgcgcacggtacagctcgtattcgtttatggcagttgagt
cattactatatttcagtgcataaagtgcggttagaatttgagttgttttctgatttaaat
attatcgaagctaaagtctcaatggtatttacagataaatgtcatttaacttttacccat
tatggcgaagaatcagcccaagcagcattacatacctattttaatattggggatattaat
caagtggaagtacaaggtttacctgaaacttgttttaatagcttaaaccaacaacaagaa
aatgttccgtcaccgcgtcacatttctgaaaatgttgattgcatttattctgcagaaaac
atgcagaatcaaatcctagataaaagtttcaatcgtacaattgcactgcatcatcataat
gcaagccaatttgttctttggaatccttggcacaaaaagacgagtggaatgagtgaaact
ggctatcaaaagatgttgtgcttagaaactgcacgtatccatcacttgcttgaatttggc
gaaagtttaagcgtagaaatttcgcttaaaggctaa

DBGET integrated database retrieval system