KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1322Help
Entry
HI1322            CDS       T00001                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hin00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HI1322 (recD)
Enzymes [BR:hin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HI1322 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1400144..1402066
Genome map
AA seq 640 aa AA seqDB search
MLSVLHKLKELRILSQGDYYFAKLIADKQCHTDYAEPVKNLAILLAALCSWRYTQGNTCS
QLDRYLEHNLFGLAYRTTEEDYLAEIHEKIGYLPVEDWQNALCGHMAFTQDPVNQIAPMA
FQFGALYFYRAWQDEYRIVQYIKNTLKKYRTLAFSYDEIHQKLEKYFPEKQEKTDWQKVA
VATAIKSPFSIITGGPGTGKTTTVTRLLLVLQELFDCKLHIKLVAPTGKAASRLEESIKN
ALGFMQEKMNVSHSLFNAIPQKASTLHSLLGVNAFNDYTRYNSHNPLQLDVLVVDETSMI
DLPMMAKLINALKPETRLILLGDQAQLASVEAGAVLGELAQFVTQPYSHEQAAYLLATTG
YKVEGSDCSNPIRDCLCHLTESRRFDKDSGIGKLSEFIQKGKADDSLELFDHYPQELHFN
SLNDEGDAVNQVVKSAVENYRTFLKMLDDLRKQKIDPNAKNEQGISYAEAIQVQFNSVRF
LTALRNNNLGVENLNKEIALALREQKLLWFRNEQDWYIGKPIMITENDHNVRLYNGDIGL
CLANGKVWFGNREVLTNRIPAHEPAFMMTIHKSQGSEFKHTVMVLPTEVNPVLSRELVFT
GVTRAKKELTVFADEKIWKTAIRQTVKRQSGLGKLLEDLN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttatctgtattacacaaacttaaagagctgcgcattctttctcaaggtgattattat
tttgctaagttgatagctgataaacaatgtcatacggattatgcggaaccagtcaaaaat
ttagccatattattagccgcactttgtagttggcgttatacgcagggaaatacttgcagc
caattagatcgctatttagaacataatttatttggcttggcttatcgcactacagaagaa
gattatttagctgaaattcatgaaaagattggttatttacccgttgaagattggcaaaat
gcgttgtgcgggcatatggcatttacgcaagatcccgtcaatcaaattgcaccaatggca
tttcaatttggcgcgttgtatttctatcgcgcttggcaagatgaatatcgcatcgtgcaa
tatataaaaaataccttaaaaaaataccgcactttagccttttcttatgatgaaattcat
caaaaattagagaaatatttccctgaaaaacaggaaaaaacagattggcaaaaagtggca
gtggcgacagcgattaaaagtccattttcgattattacaggcggcccaggaacaggaaaa
accacgacagttacgcgtttattgctcgttctacaagaattatttgattgtaaattacac
atcaaattggttgcgccgactggcaaggctgcatctcgtttggaagagtcgattaaaaat
gcgttaggttttatgcaagaaaaaatgaatgtatcccattcacttttcaatgcgattcca
caaaaagccagcaccttgcatagtttactgggcgtgaatgcctttaatgattacacacga
tataacagccataaccctttgcagttggatgtattagttgttgatgaaacatcaatgatt
gatttaccaatgatggcaaaacttatcaatgcattaaagcccgaaactcgattaatttta
ttaggcgatcaggcgcaattagcctctgttgaggcgggggctgtattgggggaattggct
caatttgttactcaaccttatagtcatgaacaagccgcatacttactagcaacaacaggc
tacaaagtagaaggttccgattgttcaaatccaatacgtgattgcttatgccatctaaca
gaaagtcgccgttttgataaagattcaggcattggcaagttgtccgaattcattcaaaaa
ggcaaagcagacgatagccttgagttatttgaccattatccgcaagaattgcactttaat
tccttaaatgatgaaggcgatgcggtcaatcaagtggtaaaaagtgcggtggaaaattac
cgcactttcttaaaaatgttggacgatttacgtaaacaaaaaattgatcctaacgctaaa
aatgaacaaggcatttcctatgccgaagctattcaagtgcaatttaattctgtgagattt
ttaaccgcacttcgtaataacaatttaggtgtcgaaaatctcaataaagaaattgcgtta
gcgttgcgagagcaaaaattgctttggttccgtaatgaacaagattggtatatcggcaag
ccaattatgattactgaaaacgatcataacgttcgcctttataacggcgatattggacta
tgcttggcaaatggcaaagtatggtttggcaatcgagaagtgctgacaaaccgaattcca
gcgcacgaacccgcttttatgatgacgattcataaatctcaaggttcagaatttaaacat
accgtcatggtgcttccaacagaagtaaatccagtattgtcgcgagaattagttttcacg
ggtgtcactcgtgcaaaaaaagaacttactgtatttgctgatgaaaaaatatggaaaaca
gcaattcgccagaccgtcaaacgccagagcggattgggaaaattattggaagatttaaat
tag

DBGET integrated database retrieval system