KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1336Help
Entry
HI1336            CDS       T00001                                 

Gene name
folP-1
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hin00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1412741..1413568
Genome map
AA seq 275 aa AA seqDB search
MKLYANNKCLDLSVPQIMGILNFTPDSFSDSGQFFSLDKALFQVEKMLEEGATIIDIGGE
STRPNADEVSEQEELHRVVPVVEAVRNRFDCWISVDSSKAVVMREAANVGMDLINDIRAL
QEPNALETAVKLALPVCIMHMQGQPRTMQANPYYENVVQDVLAFLQKRTNECLSAGIKKE
NLIWDMGFGFGKSVQHNYQLLQNLNEFCQIGYPVLAGLSRKSMIGAVLDKPVDQRIIGSA
AGALIAVQKGAKILRVHDVAATSDMLKVWQATANA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttacgcaaataataaatgtcttgatttaagcgtgcctcaaattatggggatt
cttaattttacgcctgattctttttctgatagcggacagttttttagtctagataaagca
ctttttcaagttgaaaaaatgctagaagagggggcgacaattattgatattggtggagaa
tccactcgtccgaatgcggatgaagtttctgaacaagaggaattgcatcgtgttgtgcca
gtagtggaggcggtgcgaaaccgttttgattgctggatttctgttgattcctcaaaagct
gttgtgatgcgtgaagcggcaaatgttggaatggatttgattaatgatattcgtgctttg
caagagccgaatgcgttagaaacggcggtaaaactggctttacctgtttgtattatgcat
atgcaagggcaacctcgcacgatgcaagcaaatccttattatgaaaatgtcgtgcaagat
gtattggcttttttacaaaaacgtactaatgaatgcctttctgctggcattaaaaaagaa
aatttaatttgggatatgggctttggctttggcaaatctgtacagcataattatcaatta
ttacaaaatctgaatgaattttgtcagataggttatcccgtattagcagggttatctcgc
aaatcaatgattggcgcagtgcttgataaacctgttgatcaaagaataattggcagtgcg
gcaggtgcgcttattgcagtgcaaaaaggtgcaaaaattttacgcgtacatgatgttgct
gcaacatcagatatgctcaaagtttggcaggcaacagcaaatgcctga

DBGET integrated database retrieval system