KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1389.1Help
Entry
HI1389.1          CDS       T00001                                 

Gene name
trpC
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HI1389.1 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HI1389.1 (trpC)
Enzymes [BR:hin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HI1389.1 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HI1389.1 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1486204..1487637
Genome map
AA seq 477 aa AA seqDB search
MMITQDFTKPIDSATVLQKIVLDKAQWVKAKEKEFPLSQFKQNIQNSDRSFYDALAKGTH
QKPAYILECKKASPSKGLIRAEFNLEEIANVYKHYASAVSVLTDEKYFQGNFEFLPLVRD
IVSQPVLCKDFMISEYQVYLARYYQVDAILLMLSVVNDETYRVLADLAHSLGMGVLTETS
NEEEFERALALGAKIIGVNNRNLHDLTVDLNRVVELTKKYADCIPADVRIISESGIYNHK
QIHQLQKVAHGFLIGSSLMGNQDLNNAVRSVIFGENKVCGLTRAQDVKIVYENGALYGGL
IFAEHSKRSVSLRQAQELVTAAPLRFVGVFQNQEIDFIVKIASQLQLYAVQLHGAETEAF
ITALRQQLPKNTQIWKAISVNTEAQSAVDFTDDLNVDRYIFDSQTANQQGGTGKTFDWSL
IPENLKHKIILAGGISPNNVEQAIAQGCLGLDLNSGVESSAGVKDQEKVRLVFNNIY
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcactcaagattttaccaaacccattgattccgctacggtgctacaaaaaatc
gtgcttgataaagcacaatgggttaaagcaaaagaaaaggaatttcccctttcacaattt
aaacaaaacattcaaaactctgaccgctctttttatgatgcgttagcaaaaggtacgcat
caaaagcccgcttacattttggaatgtaaaaaagcctccccttctaagggattaattcgt
gctgaatttaatttggaagaaatcgccaatgtctataaacattatgcgtccgctgtatct
gttctgacagatgaaaaatactttcaagggaattttgaattcttgcctttagttcgcgat
atcgtaagccaacctgtgctttgcaaagattttatgattagcgaatatcaagtttacctt
gctcgctactatcaagtggatgcaattttattaatgctttctgtggtaaatgatgagact
tatcgtgtgctggcagatcttgctcattctcttggtatgggcgtattgacagaaaccagt
aatgaagaagaatttgaacgtgcccttgcacttggtgcgaaaattattggtgtcaataat
cgtaacttgcacgatttaacagtagatttaaatcgtgttgttgaactcactaaaaaatac
gccgactgtattcctgctgatgtacgtattattagcgaatcaggcatttacaatcacaag
caaattcatcaattacaaaaggtggcgcatggtttcttaattgggagtagcttaatgggc
aaccaagatttgaataatgcggttcgctcagtgatttttggagaaaataaagtatgcggt
ttaacgcgcgcgcaagatgtcaaaatcgtttacgaaaacggggcactttacggcggatta
atcttcgcagaacattcaaaacgcagtgtgagtttacgccaagcgcaagaattagtaacc
gctgcgccacttcgatttgttggtgtttttcagaatcaagaaattgactttatcgtcaaa
atagccagccagttgcagctttatgcggtgcaattacatggtgcagaaactgaagcattt
attactgcacttcgccagcaactaccaaaaaacacgcaaatctggaaagcgatttcggtc
aatactgaagcccaaagtgcggtcgattttacagatgatttgaatgtggatcgttatatt
tttgatagccaaacagcgaaccaacaaggtggcacgggtaaaacctttgattggtcatta
attcctgaaaatcttaaacacaagattattttagctggaggtatctcaccaaataatgtg
gaacaagccattgcgcaaggttgcttaggtttagatcttaattctggggtggaaagttct
gcgggcgtcaaagatcaagaaaaagtgcggttagtttttaataatatttattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system