KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1397Help
Entry
HI1397            CDS       T00001                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HI1397 (holC)
   00240 Pyrimidine metabolism
    HI1397 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HI1397 (holC)
   03430 Mismatch repair
    HI1397 (holC)
   03440 Homologous recombination
    HI1397 (holC)
Enzymes [BR:hin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     HI1397 (holC)
DNA replication proteins [BR:hin03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     HI1397 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1493866..1494300)
Genome map
AA seq 144 aa AA seqDB search
MAKTAQFYILTENCTLTVEEIACNLAASIWRSGKKVLISCESEAQALEIDERLWQRDPNE
FVPHNLSGEATQYPTPIEISWLGKRNLQRRDLLINLQQEIPDFSHSFTQIIDFVPKDDAL
KTQARERYKQLRLQGWNLSTENVG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaactgcgcaattttatattcttacggaaaattgtactttaactgtcgaagaa
atagcctgtaatcttgctgcttcaatatggcgttcagggaaaaaagtactaattagttgc
gaaagtgaggctcaagcgctagagattgacgagcgtttgtggcaacgagatcctaatgaa
tttgttccacataatttatcgggtgaggcaacacaatatcccacaccgattgagatttca
tggcttggaaaacgaaatttacaacgccgcgatttgttaatcaatttgcaacaagaaatc
ccagattttagccatagttttacccaaattattgattttgtgccgaaagatgatgcgtta
aaaacacaagctcgagaacgttataaacaattacgtctgcaaggttggaatctttctact
gaaaacgtgggttaa

DBGET integrated database retrieval system