KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1432Help
Entry
HI1432            CDS       T00001                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HI1432 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HI1432 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HI1432 (trpA)
Enzymes [BR:hin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HI1432 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1520404..1521210
Genome map
AA seq 268 aa AA seqDB search
MSRFETQFATLNAKNEGAFVPFVTLCDPTFDRSFEIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALTAGHSSEDSLKLLEKVRSKYPEIPISLLLCANLIFAKGLDAFYQRCAE
VGVDAVLVADIPLLAKGDYVQTAKKHGIQPVFICPPNADEKTIQGVAKNSEGYTYLVSRA
GVTSAENQAHAANLDTLVEKLKAHNAPPILQGFGIAQPEQVKEALSLGTAGAISGSATVK
IIERNLDNHEQCLAELAEFVQTMKAATK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaacgcaatttgcgacacttaacgcaaaaaatgaaggggccttcgtg
ccgttcgttaccctttgcgaccctactttcgaccgctcttttgagatcatttgcacactt
gtggataacggtgcagatgctttagaactcggttttcctttttccgatccgctactcgat
ggcccagttattcaagccgcgaataatcgtgctttaactgcaggtcatagcagcgaagat
agcttgaaactattggaaaaagtgcggtcaaaatatccagagattccgattagcttatta
ctttgtgccaatttaatttttgctaaaggtttagatgctttttatcaacgttgtgcagaa
gttggtgttgatgctgtacttgtagcagatattccgttactggcaaaaggagattatgta
caaacagctaaaaaacacggtattcaacccgtctttatttgcccaccaaatgcggacgag
aaaacgatccaaggcgtagcgaaaaatagcgaaggctatacctatttagtctcacgtgca
ggcgtaaccagtgctgaaaatcaagctcacgcagcaaatttagatacccttgtagaaaag
cttaaagcccacaatgccccaccaattttacaaggcttcggcattgctcaaccagagcaa
gttaaagaagcgttgtctttgggcactgcgggtgcaatttcaggttcggcaacggtgaaa
attattgagcgaaatttagataatcacgagcaatgtttagctgaattagctgaatttgtt
caaacgatgaaagctgcaacaaaataa

DBGET integrated database retrieval system