KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1575Help
Entry
HI1575            CDS       T00001                                 

Gene name
alr
Definition
alanine racemase (EC:5.1.1.1)
Orthology
K01775  
alanine racemase [EC:5.1.1.1]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
D-Alanine metabolism
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; D-Alanine metabolism [PATH:hin00473]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1643226..1644308
Genome map
AA seq 360 aa AA seqDB search
MNVKPATAKISSHALKQNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTLEQNVDCFGV
ARLEEALALRSNGITKPILLLEGFFNEQDLPILAVNNIETVVHNHEQLDALKRANLPSPI
KVWLKIDTGMHRLGVALDEVDYFYQELKKLPQIQPHLGFVSHFSRADELESDYTQLQINR
FLSVTKDKQGERTIAASGGILFWPKSHLECIRPGIIMYGISPTDTIGKEFGLTPVMNLTS
SLIAVRHHKQGDPVGYGGIWTSPRDTKIGVVAMGYGDGYPRDVPEGTPVYLNGRLVPIVG
RVSMDMLTVDLGADSQDLVGDEVILWGKELPIETVAKFTGILSYELITKLTPRVITEYVD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaaaaccggcgacagcgaaaattagttcgcacgccttaaaacagaatttagaa
ataattaaacaaaaagcaccaaatagcaaaattattgctgtggttaaagcaaacgcctat
ggtcacggcgttgtattcgttgcttcaaccttagaacaaaatgttgattgctttggcgtg
gcgcgtttagaagaggctttagcattacgctccaacggcattactaaaccgattttattg
cttgaaggttttttcaatgaacaagatttgcctattctagccgttaataatattgaaacc
gtggtacacaatcacgaacagcttgatgctttaaaacgtgcgaatttaccaagtccaatt
aaggtttggttaaaaatagatacgggaatgcatcgcttgggcgttgctcttgatgaagtg
gattatttttatcaagaactgaaaaaactccctcaaattcaaccgcacttaggctttgtc
agccatttcagccgagccgatgaactagaatcagattacacccaacttcaaatcaatcgt
tttttatccgtcacaaaagataaacaaggtgaacgtactattgcagcgtcaggcggcatt
cttttctggccaaaatcccacttagaatgtatccgcccaggcattattatgtacggcatt
tctccaactgatactatcggtaaagagtttggcttaacgccagtgatgaatttaacctcg
tcattaattgccgttcgccatcataaacaaggcgatcctgtaggttacggcggtatttgg
acaagtccacgagataccaaaattggagtggtcgcaatgggttatggcgatggttatccg
cgcgatgtgccagaaggtacacctgtttatttaaatggccgtcttgtaccaattgttgga
cgtgtgtcaatggatatgcttactgttgatttaggcgcagatagccaagatttggtaggc
gatgaagtaattttatggggcaaggaattacctattgaaaccgtagctaaattcacaggc
attttaagctacgagctaattacaaaattaacacctcgtgttataactgaatacgttgat
taa

DBGET integrated database retrieval system