KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1608Help
Entry
HI1608            CDS       T00001                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hin00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1673986..1674927
Genome map
AA seq 313 aa AA seqDB search
MKSHQFSTALCQNTTESNGQPLRFPSPAKLNLFLYINGKFPNGYHELQTLFQFLDFGDWL
DISIREQDNQIVLTPEIPNLKTENNLIYRAAKLLQEKANIQLGANIHLDKILPMGGGVGG
GSSNAATALVSLNYLWQANLSIDELAKLGLTLGADVPIFVHGHAAFAEGVGEKITYCEPA
EKWFVILKPDDSISTAVIFQDPNLPRNTPKKSLAQLLSEPYKNDCEKVVINHYSNVEKAL
NWLLQYAPARLTGTGACVFAEFDHEAEAQAVFRQKPEAFFGFVAKGLNVSPLHAMLKQLS
STHTHRQSKPEVL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacatcaattttctaccgcactttgccaaaatacaacagaatcaaatgggcag
ccattacgcttccctagcccagccaaactgaatttatttctttatatcaatggaaaattt
ccgaacggctatcatgaattacaaacgcttttccaatttttagattttggcgattggtta
gacattagtattcgggaacaagataatcaaattgttttaacgccagaaattccaaatcta
aaaacggaaaataatctaatttatcgagccgcaaaacttttacaagaaaaagccaatatt
caattgggtgcaaatattcatttagataaaattcttccaatgggaggcggtgttggtggt
ggttcatccaatgcagcaaccgcattagtctctttaaattatttatggcaagccaattta
tccattgatgaactagcaaaattgggattaacattaggcgcagatgtgccaatatttgta
catggacacgcagcttttgctgaaggcgtcggggaaaaaatcacttattgtgaacctgcc
gaaaaatggtttgttatattaaaacccgatgattcaatatcgacggctgtgatatttcaa
gatccaaatttaccacgtaatacaccgaaaaaatccctcgcacaacttttgagtgaacct
tataaaaacgattgcgaaaaagttgtgataaatcattattcaaacgttgaaaaagcgtta
aactggttgctacaatatgcgccggcaagattaacaggaacgggagcctgtgtttttgct
gaatttgatcatgaagcagaagcgcaagcggtatttagacaaaaaccagaagcatttttt
ggtttcgtcgctaaaggactcaatgtgtctcccttgcacgcaatgttgaagcagctatca
tcaactcatactcatagacaatctaaacctgaggttttataa

DBGET integrated database retrieval system