KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1608Help
Entry
HI1608            CDS       T00001                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00900  Terpenoid backbone biosynthesis
hin01100  Metabolic pathways
hin01110  Biosynthesis of secondary metabolites
hin01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HI1608 (ipk)
Enzymes [BR:hin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HI1608 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 950459
NCBI-ProteinID: NP_439750
UniProt: P45271
Position
1673986..1674927
Genome map
AA seq 313 aa AA seqDB search
MKSHQFSTALCQNTTESNGQPLRFPSPAKLNLFLYINGKFPNGYHELQTLFQFLDFGDWL
DISIREQDNQIVLTPEIPNLKTENNLIYRAAKLLQEKANIQLGANIHLDKILPMGGGVGG
GSSNAATALVSLNYLWQANLSIDELAKLGLTLGADVPIFVHGHAAFAEGVGEKITYCEPA
EKWFVILKPDDSISTAVIFQDPNLPRNTPKKSLAQLLSEPYKNDCEKVVINHYSNVEKAL
NWLLQYAPARLTGTGACVFAEFDHEAEAQAVFRQKPEAFFGFVAKGLNVSPLHAMLKQLS
STHTHRQSKPEVL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacatcaattttctaccgcactttgccaaaatacaacagaatcaaatgggcag
ccattacgcttccctagcccagccaaactgaatttatttctttatatcaatggaaaattt
ccgaacggctatcatgaattacaaacgcttttccaatttttagattttggcgattggtta
gacattagtattcgggaacaagataatcaaattgttttaacgccagaaattccaaatcta
aaaacggaaaataatctaatttatcgagccgcaaaacttttacaagaaaaagccaatatt
caattgggtgcaaatattcatttagataaaattcttccaatgggaggcggtgttggtggt
ggttcatccaatgcagcaaccgcattagtctctttaaattatttatggcaagccaattta
tccattgatgaactagcaaaattgggattaacattaggcgcagatgtgccaatatttgta
catggacacgcagcttttgctgaaggcgtcggggaaaaaatcacttattgtgaacctgcc
gaaaaatggtttgttatattaaaacccgatgattcaatatcgacggctgtgatatttcaa
gatccaaatttaccacgtaatacaccgaaaaaatccctcgcacaacttttgagtgaacct
tataaaaacgattgcgaaaaagttgtgataaatcattattcaaacgttgaaaaagcgtta
aactggttgctacaatatgcgccggcaagattaacaggaacgggagcctgtgtttttgct
gaatttgatcatgaagcagaagcgcaagcggtatttagacaaaaaccagaagcatttttt
ggtttcgtcgctaaaggactcaatgtgtctcccttgcacgcaatgttgaagcagctatca
tcaactcatactcatagacaatctaaacctgaggttttataa

DBGET integrated database retrieval system