KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_00185Help
Entry
CGSHiEE_00185     CDS       T00543                                 

Definition
DNA-binding transcriptional regulator AsnC
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:hip00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36128..36937
Genome map
AA seq 269 aa AA seqDB search
MLTLNEHLLNQVLLIAYQAGKHLQQFYQKQVHVELKEDNTPVTEADLFVSQFLTEKLTAL
FPNIPVLSEENCHISFEERKNWKEYWLIDPLDGTQQFINRTDQFSVLITLVRKNKPVLSV
IHAPILSTTYYAMRDFGAFKKQLDQVKKLTKNTTNFDRPLRIAVGATTSQEKVRSILPKD
FTCEFVVVGSSSLKSGLVAEGAVDCYVRLGQTGEWDTAGAEVLLNETHGAIFDSHFEPLT
YNQRETLINPHFVMVGDQSFDWRSVFQFN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgctaaacgaacacttacttaaccaagtattgctgattgcttaccaagcaggt
aagcatttgcaacagttttatcaaaaacaggttcatgttgaattgaaagaagacaacacg
cctgtgacggaagcggatctttttgtgagccaatttttaaccgaaaaattgaccgcactt
ttccctaatatccccgttctttcggaagaaaattgtcatatttcctttgaagaacgtaaa
aattggaaagaatattggttgattgatcctcttgatggcacacaacaatttattaatcgt
accgatcaattttctgtgttgataaccttagttcgtaaaaataaacccgtgttaagtgtt
attcatgcaccaattttatcgacaacttattatgcaatgcgtgatttcggtgcgtttaaa
aaacaactggatcaggtaaaaaaactcactaaaaacacgacaaattttgaccgcccttta
cgaattgcggtaggtgcaaccacttcacaagaaaaagtgcggtcgattttgccgaaggat
tttacttgtgaatttgttgtggttggttcaagtagcttaaaaagcggtttggtggctgaa
ggtgcagtagattgttatgttcgtttaggacaaacaggcgaatgggataccgctggcgca
gaagtgttgctgaatgaaactcacggtgccatttttgactctcattttgagcctttaacc
tataaccaacgcgaaacattgattaatccgcattttgttatggtgggcgatcaatcgttc
gattggcgttctgtctttcaatttaattga

DBGET integrated database retrieval system