KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_02850Help
Entry
CGSHiEE_02850     CDS       T00543                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CGSHiEE_02850
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CGSHiEE_02850
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CGSHiEE_02850
Enzymes [BR:hip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CGSHiEE_02850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
574454..575731
Genome map
AA seq 425 aa AA seqDB search
MNLYNIKHPEEQVTFSQAVRQGLGRDQGLFFPEVIPKLNNINELLELPLVERSQKILGAL
IGEELPKATLDEMVRNAFTFTAPLEKVEDNIYALELFHGPTLAFKDFGGRFMAQALAAVR
GDGKTTILTATSGDTGAAVAHAFYGLKNINVVILYPKGKISPLQEKLFCTLGRNIRTVAI
NADFDACQALVKQAFDDVELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKEKRDNVV
VSVPSGNFGNLTAGLIAKTLGLPIKRFVASTNANDTVPRYLKSGNWDPKTTVATLSNAMD
VSRPNNWPRVEELFKRNGWDLTDLGSGMLSDSETEDTLKAMQSKGYLCEPHGAIAYQVLK
DQLKADEVGIFLCTAHPAKFKESVERILGIQLPLPETLDKHNQLPLLSDEMDNDFAQLRA
YLLKS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaatatcaaacacccagaagaacaagtcactttttctcaggctgttcgt
caaggtcttgggcgggatcaaggtttattctttccagaagttattcctaaacttaataac
attaatgaattacttgaattgcctcttgttgagcgtagccaaaaaattctaggtgcatta
attggtgaagaattaccgaaagcaacgttagacgagatggtgagaaatgcattcactttc
accgcaccgttagaaaaagttgaagataatatttatgcacttgaattatttcatggtccc
acattggcatttaaagactttggtggtcgttttatggcacaggcacttgctgcggtacgt
ggtgatggaaaaaccaccattttaacggctacgtctggcgatactggagctgctgtagca
catgcgttttatggattaaaaaatattaatgtagttatcctttatccaaaaggtaaaatc
agcccattacaagaaaagctattctgtactttaggtaggaatattcgtactgttgcgatt
aacgctgatttcgatgcgtgccaggctttagttaagcaagcctttgatgatgttgaattg
cgccaagctatcgggcttaactctgcaaattctattaatatcagccgtttattagctcaa
gtttgttattactttgaggctgtcgcacaattgccaaaagaaaaacgtgataatgtcgtg
gtttctgtgccaagcggtaattttggtaacttaacggcgggattaattgcaaaaacctta
ggcttgccgataaaacgctttgtcgcctcaacaaacgcaaatgatactgtgccacgttat
ttgaaatcgggtaattgggatcctaaaacgacagttgcaaccctttctaatgcaatggat
gtaagtcgcccaaataattggccgagagtggaggaattgtttaaacgaaatggttgggat
ttaactgatttaggttcggggatgctaagtgatagcgaaacagaagatactttaaaagcg
atgcagtcgaaaggttatttatgtgagcctcacggtgcgatagcttatcaggtgttgaaa
gatcaacttaaagcagatgaagtaggcattttcttgtgcactgcacatccagcgaaattt
aaagaatccgtagaacgtattcttggtattcagcttccattacctgaaacactggataaa
cataatcagctaccattgctttctgatgaaatggataatgattttgcacaactacgggct
tacttattgaagtcataa

DBGET integrated database retrieval system