KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_02975Help
Entry
CGSHiEE_02975     CDS       T00543                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hip00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(598800..599282)
Genome map
AA seq 160 aa AA seqDB search
MITAYIALGSNLNTPVEQLHAALKAISQLPNTHLVTTSSFYKSKPLGPQDQPDYVNAVAK
IETELSPLKLLDELQRIENEQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMHN
REFVIVPLFEIASDLVLPNSQIITELVKQFADHKMIKLNP
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattactgcatatattgcgctgggcagcaatttaaatacgccagtagaacaattacat
gctgcgcttaaagcgataagtcagttaccaaacactcatttagtaacaacgagctctttt
tataaaagcaaaccgctcggtccacaagatcaacccgattatgtgaatgccgttgcaaaa
attgaaaccgaacttagcccgctcaagctattagatgaattacagcgtattgaaaacgag
caaggtcgagtgcgtttacgtcgctggggcgaacgcacgttagatttagatattttgctt
tacggcaacgaaatcattcaaaacgaacgcttaacaattccccattatgatatgcataac
cgtgagtttgtcattgtaccgttgtttgaaatcgcatcggatttagttttaccaaatagt
caaatcataacagagctggtcaagcaatttgctgaccacaaaatgataaaattaaatccc
tag

DBGET integrated database retrieval system