KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_02975Help
Entry
CGSHiEE_02975     CDS       T00543                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CGSHiEE_02975
Enzymes [BR:hip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CGSHiEE_02975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(598800..599282)
Genome map
AA seq 160 aa AA seqDB search
MITAYIALGSNLNTPVEQLHAALKAISQLPNTHLVTTSSFYKSKPLGPQDQPDYVNAVAK
IETELSPLKLLDELQRIENEQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMHN
REFVIVPLFEIASDLVLPNSQIITELVKQFADHKMIKLNP
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattactgcatatattgcgctgggcagcaatttaaatacgccagtagaacaattacat
gctgcgcttaaagcgataagtcagttaccaaacactcatttagtaacaacgagctctttt
tataaaagcaaaccgctcggtccacaagatcaacccgattatgtgaatgccgttgcaaaa
attgaaaccgaacttagcccgctcaagctattagatgaattacagcgtattgaaaacgag
caaggtcgagtgcgtttacgtcgctggggcgaacgcacgttagatttagatattttgctt
tacggcaacgaaatcattcaaaacgaacgcttaacaattccccattatgatatgcataac
cgtgagtttgtcattgtaccgttgtttgaaatcgcatcggatttagttttaccaaatagt
caaatcataacagagctggtcaagcaatttgctgaccacaaaatgataaaattaaatccc
tag

DBGET integrated database retrieval system