KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_03745Help
Entry
CGSHiEE_03745     CDS       T00543                                 

Gene name
kgd
Definition
alpha-ketoglutarate decarboxylase (EC:1.2.4.2)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CGSHiEE_03745 (kgd)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CGSHiEE_03745 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    CGSHiEE_03745 (kgd)
Enzymes [BR:hip01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CGSHiEE_03745 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
770594..771823
Genome map
AA seq 409 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV
QAEGKTVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPAIR
RLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSARSE
KRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKFEKQHSVRLGFMS
FYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVTPVLRDCDKLSMAEIE
KQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKERPI
ALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLEI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaattcttgttccagacctacctgaatcagttgctgatgcaactgttgct
acttggcataaaaaactgggcgatactgtgaaacgtgatgaggttattgtggaaattgaa
acggataaagtcgtgctagaagttcccgcactttctgatggcgtgttggcagaagttgtt
caagctgagggcaaaacagtggtgagtaaacagttgctaggaaaaatttctacggctcaa
gaaggagatgtcagttcagcgacgttaaaagcaacgaatgaacccacaccatcagatcgt
caaaatgcagcgattgaaaatagtcataatcataatgcggatcagagccctgcaattcgt
cgtttattagcagaacatgatttacaagcagatcaaattcaaggttcaggtgtgggtggt
cgtttaacacgtgaagatattgaacgtgaaattgcaaaacgacaagcacagcaagtgaaa
caagaagctgccactgagcaaaatacaattagtacggtggcttatagcgcacgttctgaa
aaacgtgtgccaatgacccgtttgcgtaaacgtattgctgaacgtttacttgaagccaaa
aatagtacggcgatgcttaccactttcaatgaagtggatatgcagccgataatgactctg
cgtaaaacctacggcgaaaaatttgaaaaacaacattcagtacgtttaggatttatgtct
ttttatattaaagcggttgtggaagcattaaaacgttatcctgaagtgaatgcttctatt
gatggggatgatgttgtttaccataactattttgatattagtattgcagtttcaacaccg
cgtggattagtcacaccagtgcttcgtgattgcgataagctcagtatggcagagatcgaa
aaacaaattaaagcattagctgaaaaaggtcgtgatggcaaattaacagtagaagatctt
actggcggcaattttactattacaaatggtggcgtgttcggttctcttatgtccactcca
attatcaatccaccacaaagtgcgattttaggaatgcacgctattaaagaacgcccgatt
gcgcttaatggtcaagttgtgattcgtcctatgatgtaccttgctttatcttacgatcat
cgtttaattgacggccgtgaatctgttggtttcttggtagcgattaaagaattattggaa
gatccaacaagattgttattagaaatctaa

DBGET integrated database retrieval system