KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_03900Help
Entry
CGSHiEE_03900     CDS       T00543                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:hip01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hip00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hip00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hip00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(800364..801992)
Genome map
AA seq 542 aa AA seqDB search
MSKQIQIPDIGSDEVTVTEVMVNVGDTISVDQSIINVEGDKASMEVPAPEAGVVKEILVK
VGDKVSTGTPMLVLEAAGTAPVADAPTAPAADEPTAPVVATAPTASAIVEVNVPDIGGDE
VNVTEIMVAVGDTITEEQSLITVEGDKASMEVPAPFGGVVKEILVKSGDKVSTGSLIMRF
EVPGAAPAASASDSASAPQAAAPAATTAQAPQSNNNISGLSQEQVEASTGYAHATPVIRR
LAREFGVNLDKVKGTGRKGRIVKEDIEAYVKTAVKAYESGATAQATGNGVANGAGLGLLP
WPKVDFSKFGEIEEVELSRINKISGANLHRNWVIIPHVTHFDKADITDLEAFRKEQNALA
EKQKLGVKITPVVFIMKAVAKALEAYPRFNSSITEDAQRLILKKYINIGVAVDTPNGLVV
PVFKNVNKKGIIELSRELMEVSKKAREGKLTASDMQGGCFTISSLGGIGTTHFAPIVNAP
EVAILGVSKSSMEPVWNGKEFAPRLILPMSLSFDHRVIDGADGARFISYLGSVLADLRRL
VM
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattcaaattcctgatattggtagtgatgaagttaccgtaacagaagtg
atggtaaacgtaggcgataccatttctgttgatcaatctatcattaacgttgaaggcgat
aaagcttcaatggaagtgcctgcaccagaagcgggtgttgtaaaagaaattttagtgaaa
gtgggcgataaagtttcaactggtactccaatgcttgtattagaagcggcaggtactgct
ccagtagctgatgcgcctactgctccagcagctgatgagcctactgcaccagtggttgct
accgcaccaacggcttcagctattgtagaagtaaatgtgccagatattggtggcgatgaa
gtcaatgtaaccgaaattatggttgcagttggcgatacaatcactgaagaacaatcttta
attaccgttgaaggcgataaagcctcaatggaagttcctgcaccattcggcggtgtggta
aaagaaattttagtgaaatcaggcgataaagtttcaactggttcattaattatgcgtttt
gaagtaccaggtgcagctccagcagcatcagcatcagattcagcatcagcaccacaggca
gcagctcctgctgctactactgcacaagcacctcaatcaaataacaacatatctggatta
agccaagaacaagtagaagcaagtacaggatatgcacacgcaacaccagttattcgtcgt
ttagctcgtgaatttggtgtaaatctagataaagtaaaaggtactggtcgtaaaggtcgt
atcgttaaagaagatattgaagcttatgtgaagaccgcagttaaagcttatgaaagcggt
gcaacagcacaagctactggcaatggtgtagcaaatggtgctggattaggcttattgcca
tggccaaaagttgatttcagtaaatttggcgaaattgaagaagttgaattaagtcgtatc
aacaaaatttcaggtgctaacttacatcgtaactgggtaataattccacacgttactcac
ttcgataaagcagatatcacggatttagaagcattccgtaaagaacaaaatgcgttagca
gaaaaacaaaaacttggtgtaaaaatcacgccagttgtgttcattatgaaagcggtggca
aaagcattagaagcgtatccacgtttcaacagctcaattaccgaagatgctcaacgctta
atcctgaaaaaatatattaacatcggtgtcgcagtagatacgccgaatggcttagtagtg
cctgtattcaaaaatgtgaacaagaaaggcattatcgaactttcacgtgaattaatggaa
gtgtcgaaaaaagcccgtgaaggcaaattgactgcatctgatatgcaaggtggctgtttc
accatttcaagtcttggtggtattggtacaacgcactttgcgccaatcgtaaatgcgcca
gaagtagctatccttggtgtgtctaaatcatcaatggagccagtatggaacggtaaagaa
tttgcaccacgcttaattcttccaatgtcattatcattcgaccaccgtgtcattgatggt
gcagatggtgctcgtttcattagctatcttggctcggttttagcagatttacgtcgctta
gtaatgtaa

DBGET integrated database retrieval system