KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_04305Help
Entry
CGSHiEE_04305     CDS       T00543                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CGSHiEE_04305
Enzymes [BR:hip01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CGSHiEE_04305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
893539..895629
Genome map
AA seq 696 aa AA seqDB search
MQISDSLKQKAEKCGIALSHYDIDGHLIFADEKTVSTFVELLQPPPKAKGQFDDVLAAFE
NEPIDYRLNRLDLPPSAEYRYQLIDESNAILLEKILSNLSALSLPPLPFGYYQLSIFSDT
EQYRVRLLISPKTAFQPPVLENKKVWGVNVQLYSLRSEQNWGIGDFGDLAYLIEQSAKQG
ADYVGINPLHLPYPAVPNWTSPYSSSSRRWLNFLYLAILDLPEFKRCRSVQNWFKREDIQ
AKIAALRESDCVDYSSILALKLTALESLFDFFQRSQSAEIVTRRKIFADYLKNKGEPLLL
QGLFNVLDLQEHADHQAEENTIGWLGWRKEWQHLSAAKRKALLKTHHEKIQFFAWLQWLT
EEQLSALQNLCKQSGMGLGIYGDLAVNSSRGSADVWSDPDLYCVNASIGAPPDPLGPVGQ
NWNLPPYNPTVLKARGFAPFIDMLRANMQYFGVLRIDHVMGLFRLWWIPKGKTAADGAYV
HYPFDELMAILAIESVRNECLIIGEDLGTVPDEVRWKLNEFQMFSYFVLYFAQRNGEFPR
ISDYPRNAYATIGTHDVPSLQSFWHCRDLELFNQLGILNGEVIKQKYDQRVMDKQALLNS
LHRDNYLPPHYEGDALSMAMHDYLNRMIHYYLAESNSRLIGVQLENLLSQEISFNLPATS
NEYPNWCKKLAQPLAFIFSNEALKTFFVQINQGRNV
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatctcggattctctcaaacaaaaagcagaaaaatgcggtatcgcactttctcat
tatgatattgatggacatcttattttcgcggatgaaaagacggtttcaacttttgttgaa
cttttgcagcctccgccaaaagcgaaaggacagtttgacgatgttctggctgcatttgaa
aatgaaccgattgattatcgactcaatcgtctagatttgccaccatctgcggaatatcgt
tatcagctgattgatgaatctaatgctattctgttagaaaaaatactttcaaatttatcc
gcactttctttgcctccacttccttttggctattatcaattatctattttttccgatact
gaacagtaccgtgttcgtttacttatttctcctaaaacagcttttcaaccacccgtatta
gaaaataaaaaagtgtggggcgtgaatgtgcaactttacagtttacgctcagaacaaaac
tgggggattggcgattttggcgatttggcctatttgattgaacaaagtgcaaaacaaggg
gcggattatgtgggaattaatccattacatttgccgtatcctgctgtgccaaactggact
agcccttatagttcatcctctcgtcgttggttgaatttcttatatttggccattcttgat
ttacccgaatttaagcgttgccgttcagtacaaaattggtttaagcgtgaggatattcaa
gcaaaaattgctgctttacgtgaaagtgattgcgtcgattattcttcaattttggcttta
aaattaaccgcacttgagtccctgtttgatttctttcagcgtagtcaatccgctgaaatt
gtgacacgtcgaaaaatctttgctgattatttaaaaaacaaaggtgaacctttgttgtta
cagggtttatttaatgtcttggatttgcaagaacatgctgaccatcaagcagaagaaaat
accataggttggcttggctggcgtaaggaatggcagcatttaagtgcggcaaaaagaaaa
gctctattaaaaacacaccatgagaaaatccaattttttgcttggttgcaatggcttaca
gaagaacaactttccgcattacaaaatctttgtaaacagtctggtatggggttgggtatt
tatggcgatttagccgtaaatagttctcgtggcagtgctgatgtatggagcgatcctgat
ttatattgtgtaaatgcctctattggtgcgccgcccgatccgttaggccctgtagggcaa
aattggaatttgccaccttataatccaacagtattaaaagcacgtggctttgcaccattt
atcgatatgctacgtgccaatatgcaatatttcggtgtgctacgcatcgatcatgttatg
ggcttatttcgtttgtggtggattccaaaaggaaaaaccgcggctgacggtgcttatgtg
cattatccttttgatgaattaatggcgattcttgccattgaaagtgtacgcaatgaatgt
ttgattattggtgaagatctcggcactgtgcctgatgaagtgaggtggaaattaaacgag
tttcaaatgttctcttattttgtattgtatttcgcccaacgaaatggcgaatttcctcgt
atatctgattatcctcgaaatgcttatgccactattggtacacatgatgttccctcatta
caaagtttttggcattgccgtgatttagaattatttaatcaacttggtattctgaatggg
gaagtgatcaagcaaaaatatgatcaacgtgttatggataaacaagctttattaaatagt
ttacatcgtgataattatttaccgccgcattatgaaggcgatgccctttctatggcgatg
cacgattatttaaatcgaatgatccattattatttagcggaaagtaacagccgattgatt
ggtgtgcaattagaaaatttacttagccaagaaatcagttttaatttaccggccacctca
aatgaatacccaaattggtgcaagaaacttgctcaaccgttagcgtttatttttagcaat
gaagctttaaaaacgttctttgtgcaaattaaccaagggcgaaatgtataa

DBGET integrated database retrieval system