KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_04555Help
Entry
CGSHiEE_04555     CDS       T00543                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hip00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hip00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:hip03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:hip03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hip03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(951974..952408)
Genome map
AA seq 144 aa AA seqDB search
MAKTAQFYILTENCTLTVEEIACNLAASIWRSGKKVLISCESESQALEIDEILWQRDPNE
FVPHNLSGEATQYPTPIEISWLGKRNLQRRDVLINLQQEIPDFSHSFTQLIDFVPKDDAL
KTQARERYKQLRLQGWNLSTENVG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaactgcacaattttatattcttactgaaaattgtactttaactgtcgaagaa
atagcctgtaatcttgctgcctcaatatggcgttcagggaaaaaagtactaattagttgc
gaaagtgagagccaagcattagaaattgatgaaattttgtggcaacgagatcctaatgaa
tttgttccacataatttatcaggtgaggcaacgcaatatcccacaccgattgagatatcg
tggcttggaaaacgaaatttacaacgtcgtgatgtgttaattaatttgcaacaagaaatt
ccagattttagccacagttttacccaacttattgattttgtaccgaaagatgatgcgtta
aaaacacaagcccgagaacgttataaacaattacgtctgcaaggttggaatctttctact
gaaaacgtgggttaa

DBGET integrated database retrieval system