KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_04740Help
Entry
CGSHiEE_04740     CDS       T00543                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00260  Glycine, serine and threonine metabolism
hip00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hip01100  Metabolic pathways
hip01110  Biosynthesis of secondary metabolites
hip01130  Biosynthesis of antibiotics
hip01230  Biosynthesis of amino acids
Module
hip_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CGSHiEE_04740
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CGSHiEE_04740
Enzymes [BR:hip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CGSHiEE_04740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABQ98341
UniProt: A5UC40
Position
973929..975122
Genome map
AA seq 397 aa AA seqDB search
MSDTLLNPYFGEFGGMYVPEILVPVLKQLEQAFVEAQNDPTFQAEFADLLKNYAGRPTAL
TLCRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSCSLKDACCEAMRDWSA
NYETTHYLLGTAAGPHPFPTIVKEFQKMIGEETKRQILEREGRLPDAVIAAVGGGSNAIG
MFADFIDESNVRLIGVEPAGKGIETGEHGAPLKHGTTGIYFGMKSPIMQDKDGQIEESYS
ISAGLDFPSVGPQHAYLNEIGRADYVSITDEEALNAFQELAKHEGIIPALESSHALAYAL
KLIKQNPEKEQLLVVNLSGRGDKDIFTVDKILNGGTN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacacacttcttaacccttattttggcgaatttggcggaatgtatgtacccgaa
attttagtgcctgttttaaagcaattagaacaagcctttgtggaggctcaaaatgatcct
acattccaagcagaatttgctgatttactcaaaaattatgcgggcagaccgaccgcactt
actctttgtcgtaacttaaccaaaggtacaaaaactaaactttatcttaaacgtgaagat
ttattacacggtggtgcacacaaaaccaaccaagtgttagggcaaattttattggctaaa
cgtatgggcaaaacgcgtattattgccgaaacaggtgcagggcaacacggcgtggcaaca
gccctagcttgtgctatgttagatatgccgtgccgtgtttatatgggggcaaaagatgtt
gagcgtcaatcaccaaacgtgttccgtatgcgtttaatgggcgcggaagtgattcctgta
caaaaaggctcttgttctttaaaagatgcctgttgtgaagcgatgcgtgattggtcagca
aactatgaaactacccattatttacttggaacggcggcaggccctcaccccttcccgacg
attgtgaaagaatttcaaaaaatgattggcgaagaaaccaaacgtcaaattctcgaacgg
gaaggtcgtttacctgatgcagtcattgctgctgttggcggtggctcgaatgcaattggt
atgtttgctgattttattgatgaatccaatgtgcgtttaattggtgttgagcctgcgggt
aaaggtattgaaacgggcgaacacggtgcaccgctcaagcacggcacaacaggcatctac
ttcggaatgaaatcgccaattatgcaagataaagatggacaaattgaggaatcctattcc
atttctgcagggttagattttccctctgtcgggccgcaacatgcttatttaaatgagatt
ggtcgtgctgattatgtatcgattaccgatgaagaagcccttaacgcattccaagaattg
gcaaaacacgaaggtattattcctgcattagaaagctcacacgccttggcttatgccttg
aaattgattaaacaaaatcctgaaaaagaacaacttttagtggttaatctttcaggacga
ggcgataaagatatttttaccgttgataaaattttaaatggaggaacgaactaa

DBGET integrated database retrieval system