KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_04740Help
Entry
CGSHiEE_04740     CDS       T00543                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CGSHiEE_04740
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CGSHiEE_04740
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CGSHiEE_04740
Enzymes [BR:hip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CGSHiEE_04740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
973929..975122
Genome map
AA seq 397 aa AA seqDB search
MSDTLLNPYFGEFGGMYVPEILVPVLKQLEQAFVEAQNDPTFQAEFADLLKNYAGRPTAL
TLCRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSCSLKDACCEAMRDWSA
NYETTHYLLGTAAGPHPFPTIVKEFQKMIGEETKRQILEREGRLPDAVIAAVGGGSNAIG
MFADFIDESNVRLIGVEPAGKGIETGEHGAPLKHGTTGIYFGMKSPIMQDKDGQIEESYS
ISAGLDFPSVGPQHAYLNEIGRADYVSITDEEALNAFQELAKHEGIIPALESSHALAYAL
KLIKQNPEKEQLLVVNLSGRGDKDIFTVDKILNGGTN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacacacttcttaacccttattttggcgaatttggcggaatgtatgtacccgaa
attttagtgcctgttttaaagcaattagaacaagcctttgtggaggctcaaaatgatcct
acattccaagcagaatttgctgatttactcaaaaattatgcgggcagaccgaccgcactt
actctttgtcgtaacttaaccaaaggtacaaaaactaaactttatcttaaacgtgaagat
ttattacacggtggtgcacacaaaaccaaccaagtgttagggcaaattttattggctaaa
cgtatgggcaaaacgcgtattattgccgaaacaggtgcagggcaacacggcgtggcaaca
gccctagcttgtgctatgttagatatgccgtgccgtgtttatatgggggcaaaagatgtt
gagcgtcaatcaccaaacgtgttccgtatgcgtttaatgggcgcggaagtgattcctgta
caaaaaggctcttgttctttaaaagatgcctgttgtgaagcgatgcgtgattggtcagca
aactatgaaactacccattatttacttggaacggcggcaggccctcaccccttcccgacg
attgtgaaagaatttcaaaaaatgattggcgaagaaaccaaacgtcaaattctcgaacgg
gaaggtcgtttacctgatgcagtcattgctgctgttggcggtggctcgaatgcaattggt
atgtttgctgattttattgatgaatccaatgtgcgtttaattggtgttgagcctgcgggt
aaaggtattgaaacgggcgaacacggtgcaccgctcaagcacggcacaacaggcatctac
ttcggaatgaaatcgccaattatgcaagataaagatggacaaattgaggaatcctattcc
atttctgcagggttagattttccctctgtcgggccgcaacatgcttatttaaatgagatt
ggtcgtgctgattatgtatcgattaccgatgaagaagcccttaacgcattccaagaattg
gcaaaacacgaaggtattattcctgcattagaaagctcacacgccttggcttatgccttg
aaattgattaaacaaaatcctgaaaaagaacaacttttagtggttaatctttcaggacga
ggcgataaagatatttttaccgttgataaaattttaaatggaggaacgaactaa

DBGET integrated database retrieval system