KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_04745Help
Entry
CGSHiEE_04745     CDS       T00543                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CGSHiEE_04745 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CGSHiEE_04745 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CGSHiEE_04745 (trpA)
Enzymes [BR:hip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CGSHiEE_04745 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
975122..975928
Genome map
AA seq 268 aa AA seqDB search
MSRFETQFATLNAKNEGAFVPFVTLCDPTFDRSFEIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALTAGHSSEDSFKLLEKVRSKYPEIPISLLLCANLIFAKGLDAFYQRCAE
VGVDAVLVADIPLLAKEDYVQAAKKHGIQPVFICPPNADEKTIQGVAKNSEGYTYLVSRA
GVTSAENQAHAANLDTLVEQLKAHNAPPILQGFGIAQPAQVKEALALGAAGAISGSATVK
IIERNLDNHEQCLAELAEFVQTMKAATK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaacgcaatttgcgacacttaacgcaaaaaatgaaggggctttcgtg
ccgttcgttaccctttgcgaccctactttcgaccgctcttttgagatcatttgcacactt
gtggataacggtgcagatgctttagaactcggttttcctttttccgatccgctactcgat
ggcccagttattcaagccgcgaataatcgtgctttaactgcaggtcatagcagtgaagat
agctttaaactattggaaaaagtgcggtcaaaatatccagagattccgattagcttatta
ctttgtgccaatttaatttttgctaaaggtttagatgctttttatcaacgttgtgcagaa
gtcggggttgatgctgtgcttgtggcagatattccgttactggcaaaagaagattatgta
caagcggctaaaaaacacggtattcaacccgtctttatttgcccacccaatgcggacgag
aaaacaattcaaggcgtagcgaaaaatagcgaaggatatacctatttagtctcacgtgca
ggcgtaaccagtgctgaaaatcaagctcacgcagcaaatttggacacccttgtagaacaa
cttaaagcccacaatgccccaccaattttacaaggcttcggcattgcacagcctgcacaa
gttaaagaagccttagctttgggggcggctggtgcaatttcaggttcagcaacagtaaaa
attattgagcgaaatttagataatcacgagcaatgtttagctgaattagctgaatttgtt
caaacgatgaaagctgcaacaaaataa

DBGET integrated database retrieval system