KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05000Help
Entry
CGSHiEE_05000     CDS       T00543                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hip03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1012602..1014524)
Genome map
AA seq 640 aa AA seqDB search
MLSVLQKLKEQGILSQGDYYFAKLIADKQCHMDYAEPIKNLAILLAALCSWRYTQGNTCS
QLDRYLENNLFGLAYRTTEEDYLAEIHEKIGYLPVEDWQNALCGHMAFTQDPVNQIAPMA
FQFGALYFYRAWQDEYRIAQYIKNTLKKYRTLAFSYDEIHQKLEKYFPEKQEKTDWQKVA
VATAIKSPFSIITGGPGTGKTTTVTRLLLVLQELFDCKLHIKLVAPTGKAASRLEESIKN
ALGFMQEKMNLSDSLFNAIPQKASTLHSLLGVNAFNDYTRYNSHNPLQLDVLVVDETSMI
DLPMMAKLINALKPETRLILLGDQAQLASVEAGAVLGELAQFVNQPYSHEQAAYLQATTG
YEVKGADCSNPIRDCLCHLTESRRFDKDSGIGKLAEFIQKGKADDGLGLFEHYPQELHFN
ALNDESDAVNQVVKSAVENYRTFLKMLDDLRKQKIDPNAKNEQGISYAEAIQAQFNSVRF
LTALRNSDLGVENLNKEIALALRAEKLLWFRNEQDWYIGKPIMITENDHNVRLYNGDIGL
CLANGKVWFGNREVLTSRIPAHEPAFMMTIHKSQGSEFKHTVMVLPTEVNPVLSRELVFT
GVTRAKKELTVFTDEKIWKTAIRQTVKRQSGLGKLLEDLN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttatcagtactacaaaaacttaaagagcagggcattctttctcaaggtgattattat
tttgctaagttgatagctgataaacaatgtcatatggattatgcagaaccaatcaaaaat
ttagctatattattagccgcactttgtagttggcgttatacgcagggaaatacttgcagc
caattagatcgctatttagaaaataatttatttggcttggcttatcgtacaacggaagaa
gattatttagctgaaattcatgaaaagattggttatttacccgttgaagattggcaaaat
gcgttgtgcgggcatatggcatttacgcaagatcccgtcaatcaaattgcaccaatggca
tttcaatttggcgcgttgtatttctatcgcgcttggcaagatgaatatcgcatcgcacaa
tatataaaaaataccttaaaaaaataccgcactttagccttttcttatgatgaaattcat
caaaaattagagaaatatttccctgaaaaacaggaaaaaacagattggcaaaaagtggca
gtggcgacagcgattaaaagtccattttcgattattacaggcggcccaggaacaggaaaa
accacgacagttactcgtttattgctcgttctacaagaactatttgattgtaaattacac
atcaaattggttgcgccgactggcaaagcagcctctcgtttggaagagtcgattaaaaat
gcgttaggttttatgcaagaaaaaatgaatttatccgattcacttttcaatgcgattcca
caaaaagccagtaccttgcatagtttactgggcgtgaatgcctttaatgattacacgcgc
tataacagccataatcctttgcagttggatgtattagttgttgatgaaacatcaatgatt
gatttgccgatgatggcaaaacttatcaatgcgttaaagcccgaaactcgattaatttta
ttaggcgatcaggcgcaattagcctctgttgaggcgggggctgtattgggggaattggca
caatttgttaatcaaccttatagtcatgaacaagctgcgtatttacaagcgacaacagga
tacgaagtaaaaggtgctgattgttcaaatccaatacgtgattgcttatgccatctaaca
gaaagccgccgttttgataaagattcaggtattggcaagttggctgaattcattcaaaaa
ggcaaagcagacgatggccttgggttatttgaacattatccgcaagaattgcactttaat
gccttaaatgatgaaagcgatgcggttaatcaagtggtgaaaagtgcggtggaaaattac
cgcactttcttaaaaatgttggacgatttacgtaaacaaaaaattgatcctaacgctaaa
aatgaacaaggcatttcctatgccgaagctattcaagcacaatttaattctgtgaggttt
ttaaccgcacttcgtaatagcgatttaggtgttgaaaatctcaataaagaaatcgcgtta
gcgttgcgagcggaaaaattgctttggttccgtaatgaacaagattggtatatcggcaag
ccaattatgattactgaaaacgatcataacgttcgcctttataacggcgatattggcctg
tgcttggcaaatggcaaagtatggtttggcaatcgagaagtgctgacaagccgaattcca
gcgcatgagcccgcttttatgatgacgattcataaatctcaaggttcagaatttaaacat
accgtcatggtgcttccaacagaagtaaatccagtactgtcgcgagaattagttttcacg
ggcgtcactcgtgcgaaaaaagaactcacagtatttaccgatgaaaaaatatggaaaaca
gcgattcgccagaccgtcaaacgccagagcggattgggaaaattattggaagatttaaat
tag

DBGET integrated database retrieval system