KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05730Help
Entry
CGSHiEE_05730     CDS       T00543                                 

Definition
(GenBank) HicB
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1146425..1146769)
Genome map
AA seq 114 aa AA seqDB search
MKLLNYKGYVGTIEADLENNILFGKLAYIRDLVTYEAESLSELEKEFRQSVDLYLQDCLE
LGKEPNKPFKGVFNVRIGEELHREATIIAGDRSLNAFVTEAIQEKIFREKPSLR
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaagttattaaattataaaggttatgttggcacgattgaggcggatttagaaaacaat
atattgtttggcaaacttgcttacattcgtgatttagtgacttacgaagcagagtcatta
tctgagctagaaaaagaatttcgtcaatctgttgatttatatttacaagattgtttggaa
ttaggtaaagaaccgaataagccttttaaaggtgtatttaatgtacgaattggcgaggaa
ttgcatagagaagctacgatcatagcaggcgatcgttctcttaatgcttttgttacggaa
gcgattcaagaaaaaatttttcgtgaaaaaccaagtttaagataa

DBGET integrated database retrieval system