KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05745Help
Entry
CGSHiEE_05745     CDS       T00543                                 

Definition
(GenBank) phosphoribosylaminoimidazole carboxylase ATPase subunit
  KO
K01589  5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00230  Purine metabolism
hip01100  Metabolic pathways
hip01110  Biosynthesis of secondary metabolites
hip01130  Biosynthesis of antibiotics
Module
hip_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CGSHiEE_05745
Enzymes [BR:hip01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     CGSHiEE_05745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABQ98512
Position
1147749..1148837
Genome map
AA seq 362 aa AA seqDB search
MQNSTLYPTVYVLGNGQLGRMLGYAGAPLDIYVEPLAFNAPVFDLPENAIITAEIERWEK
TPLTELLGNHKNFVNQHVFGLLADRFAQKSLLDELNLSTSPWCLLKDKTQWNDVFQTVGE
KVVVKRRTGGYDGRGQWIISDENKADITDDLFGEVIAEKFIPFDYEVSIVGARFKNGEKR
FYPVTHNLQQNGILRYSVIDNAFPQQSAQQKQAETMLGKIMDKLGYVGVMAMECFVVGDK
LLINELAPRVHNSGHWTQLGCAISQFELHLRTLLDLPTPDLQIFAPSVMVNLIGTNHNPK
WLNIPFAQLHWYGKEVRAGRKVGHINLSHPNKAVIIQQLEKLRIELPEDYQSGLNWAIEK
LK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaactccaccttatacccaacggtttatgtacttggcaacggacaactcggcaga
atgttaggttacgctggtgcacctttagatatttatgttgaacccttagccttcaatgcg
ccagtttttgacttacctgaaaatgcgatcatcacggcagaaattgaacgctgggaaaaa
acacctttgactgaattactcggcaatcataaaaacttcgttaatcaacatgtatttgga
ttattagccgatcgttttgctcaaaaatccttgcttgatgaactcaatctttctacctcg
ccttggtgtttattaaaagataaaacgcaatggaatgatgttttccaaactgttggcgag
aaagtcgtcgtcaaacgtagaacaggcggatatgatgggcgtggtcaatggattatcagc
gatgaaaacaaagcggacatcactgatgacttatttggtgaagtgatcgcagaaaaattt
attccttttgattatgaagtttctattgtaggcgcaagatttaaaaatggcgaaaagcgt
ttttatcccgttacgcataacctgcaacaaaatggtattttgcgttacagtgtgattgat
aatgcatttcctcaacaatccgcacaacaaaaacaagctgaaacaatgctcggcaaaatt
atggataagttaggctatgtgggtgtgatggcaatggaatgttttgttgtaggcgacaaa
ttactaattaacgaacttgcgcctcgcgtacataacagtggacattggacacaactggga
tgtgctattagtcaatttgaattacatttacgcacgctacttgatttgccaacacctgac
ttacaaatttttgccccaagtgtaatggtaaatttaatcggcacaaaccataatccaaaa
tggcttaatataccttttgcacaacttcattggtacggtaaagaagtgagggctgggcgt
aaggttgggcatatcaatctttctcatcctaataaagcggtcattattcaacaattagaa
aagctccgaattgaattacccgaagattatcaatcaggattaaattgggcgattgaaaaa
ctaaaataa

DBGET integrated database retrieval system