KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05770Help
Entry
CGSHiEE_05770     CDS       T00543                                 

Definition
(GenBank) hypothetical protein
  KO
K16915  nickel transport protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip02010  ABC transporters
Module
hip_M00246  Nickel transport system
Brite
KEGG Orthology (KO) [BR:hip00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CGSHiEE_05770
Transporters [BR:hip02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Nickel transporter [MD:M00246] [OT]
    CGSHiEE_05770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABQ98517
Position
complement(1152153..1152641)
Genome map
AA seq 162 aa AA seqDB search
MKKFAFLTALFAACYLPNAYAHALYVFAQYDGQTLSGKSYYSDMTPAAETYLEVFRSGVS
DPVLTGKTDRQGAFKLSIADVPHTTLKVVVEGDEGHRASVVAAAHTSAENQSSADLMLLR
EDIAHLKDKIYLHDILGGIGYIVGIAGLIALRNARKIKQGRI
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttgcttttttaaccgcactttttgcggcttgctatctcccgaatgcttat
gcccacgcgctttatgtgtttgcccaatatgatgggcaaacactttctggcaaatcctat
tattctgatatgaccccagcagctgaaacttatttagaagttttccgctcaggtgtttct
gatcccgttttaactggaaaaacagaccgccaaggtgcatttaagctttctattgctgat
gtaccacatacaaccttaaaagttgtggtggaaggcgatgaaggacaccgtgcgtccgtt
gttgctgctgctcatacgtctgccgaaaatcaaagcagtgcagatttaatgctgcttcgt
gaagatattgcgcatttaaaagataaaatttatttgcatgatattttaggtggaatcggt
tatatcgttggtattgctggacttattgctttacgtaatgcgcgtaaaattaaacaagga
cgtatttaa

DBGET integrated database retrieval system