KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05775Help
Entry
CGSHiEE_05775     CDS       T00543                                 

Definition
(GenBank) putative ABC-type Co2+ transport system, periplasmic component
  KO
K10094  nickel transport protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip02010  ABC transporters
Module
hip_M00246  Nickel transport system
Brite
KEGG Orthology (KO) [BR:hip00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CGSHiEE_05775
Transporters [BR:hip02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Nickel transporter [MD:M00246] [OT]
    CGSHiEE_05775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4198
Motif
Other DBs
NCBI-ProteinID: ABQ98518
Position
complement(1152654..1153337)
Genome map
AA seq 227 aa AA seqDB search
MELKKIAVGLTALLGMSVANAHNVWLEPASSQDEYVVKFGHEQTETYPESKLKSIQALNA
QGKLTAVDYQFRNGEAYLMPKSDLVFVHFDNGVWSKLPSGKYVEKTKREEPTAEFSTNPV
KFGKAILKWDAESFKSHQQAYELIPQEKAQANKPLSILVLHNGKPVQGIKVGVSEDAPFN
LTNEKGIAQFTPTKGFNKVWAEFEEKVTNNADYDRRTVEYMLTFDAQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattgaaaaaaatcgctgtaggattaaccgcacttttaggtatgtctgttgctaac
gcacataatgtttggcttgagcctgcttcatcgcaagatgaatacgtagtgaaatttgga
catgaacaaactgaaacctatccagaatctaaacttaaatctatccaagccttaaatgcg
caaggcaaattaactgctgttgattaccaattcagaaatggcgaagcctatcttatgcct
aaatcagatttagttttcgttcatttcgataatggtgtatggtcaaaattaccaagcggt
aaatacgttgaaaaaacaaaacgtgaagaaccaacagcagaatttagtactaatcctgtt
aaatttggtaaagcgattttgaaatgggatgctgaatctttcaaatctcatcaacaagca
tacgaattgattcctcaagaaaaagcacaagcgaataaaccactttctatccttgtttta
cataatggtaaaccagttcaaggcattaaagtgggtgtgagtgaagatgcaccgttcaat
ttaactaatgaaaaaggtatcgctcaatttaccccaactaaaggcttcaacaaagtatgg
gcagagtttgaggaaaaagtaacaaataatgcagattacgatcgtcgaactgtggaatat
atgctaacttttgacgcgcaataa

DBGET integrated database retrieval system