KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05815Help
Entry
CGSHiEE_05815     CDS       T00543                                 

Definition
(GenBank) 50S ribosomal protein L25
  KO
K02897  large subunit ribosomal protein L25
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip03010  Ribosome
Module
hip_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:hip00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    CGSHiEE_05815
Ribosome [BR:hip03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    CGSHiEE_05815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L25p
Motif
Other DBs
NCBI-ProteinID: ABQ98524
UniProt: A5UCM3
Position
1156887..1157174
Genome map
AA seq 95 aa AA seqDB search
MAFKFNAEVRTAQGKGASRRLRNNGQIPAIVYGGSEEPVSIILNHDELNNAQAHESFYSE
VITLVIGGKEVAVKVQAMQRHPFKPKLVHIDFKRA
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggcatttaaatttaacgctgaagttcgtacagcgcaaggtaagggtgcgagccgccgc
ctgcgtaacaatggtcaaatccctgcaatcgtttatggtggcagcgaagagcccgtttca
atcatcttaaaccacgatgaattaaacaacgcgcaagcacacgaatctttctattctgaa
gtgattactttagtgatcggtggtaaagaagttgcagttaaagtacaagcaatgcaacgt
cacccattcaaaccaaaattggttcacattgacttcaaacgcgcgtaa

DBGET integrated database retrieval system