KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05905Help
Entry
CGSHiEE_05905     CDS       T00543                                 

Definition
(GenBank) ABC-type transport system, ATPase component, involved in antimicrobial peptide resistance
  KO
K19230  cationic peptide transport system ATP-binding protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip01503  Cationic antimicrobial peptide (CAMP) resistance
hip02010  ABC transporters
Module
hip_M00739  Cationic peptide transport system
Brite
KEGG Orthology (KO) [BR:hip00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CGSHiEE_05905
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CGSHiEE_05905
Transporters [BR:hip02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Cationic peptide transporter [MD:M00739] [OT]
    CGSHiEE_05905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_29 AAA_22 AAA_23 AAA_16 AAA DUF2813 RsgA_GTPase SMC_N AAA_21 AAA_15 DUF87 AAA_10 G-alpha Mg_chelatase AAA_24 NACHT IstB_IS21 T2SSE AAA_30 Arylsulfotran_N AAA_13 MMR_HSR1 AAA_5
Motif
Other DBs
NCBI-ProteinID: ABQ98540
Position
1174079..1174888
Genome map
AA seq 269 aa AA seqDB search
MPLLQVEDLTKTFKGHASLFGRNQFNAVDKVSFTLERKQTLAIIGNNGSGKSTLVKMIAG
IIPPTSGRILFNDRELQYQDAQSSAKHIRMVFQDANSAFNPRLNIGQILDEPLSLATDWT
ETQRNEKIFETLSLVGLYPDYTNLNIKHLSISQKQRVALARALILEPEIIIIDDAIGNLD
ASVRIQLLNLTLDLQQRLGISYIYVGQDLGVIKHIADTIIVMDEGKMIEYGSPQNLFTAP
QTDVTRRLVESYFGKILDETAWVKDKNTH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcccttattacaagtggaagatttaactaaaacttttaaaggtcacgccagtttattt
ggtcgaaatcaattcaatgcagtggataaagtgagttttacccttgaacgtaaacaaaca
cttgcaatcattggcaataatggctctggtaaatcaaccctagtgaaaatgatagcaggc
attattccgccaacttctggtcgaattttatttaatgatcgagaattacaatatcaggat
gcccaatctagcgctaaacatattcgtatggttttccaagatgccaattctgcatttaac
ccacgtttaaatattggacaaatattagacgaaccattaagcctagcgacagattggaca
gaaacacaacgtaatgaaaaaatctttgagaccctctctcttgttggactttatcctgat
tacacaaatctcaatattaagcatctttctattagccaaaaacagcgtgtcgctttggca
cgtgcgctgattttagaacctgaaataattattatagatgatgcaattggtaatttagat
gcctcggtgcgcattcaattactaaatttaacccttgatctgcagcaacgtttaggtatt
tcttatatttatgtagggcaagatctcggtgtaattaaacatattgcagatacgattatc
gtaatggatgaaggaaaaatgattgaatatggcagccctcaaaatctttttaccgctcca
caaactgatgttactcgtcgcttagtcgaaagctattttggcaaaattttagatgaaacc
gcttgggtaaaagacaaaaacactcactaa

DBGET integrated database retrieval system