KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05910Help
Entry
CGSHiEE_05910     CDS       T00543                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K19239  
predicted membrane protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:hip00001]
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CGSHiEE_05910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1174900..1175916
Genome map
AA seq 338 aa AA seqDB search
MNTRPFYFGLIFIAIIAILANYLGSTDFSHHYHISALIIAILLGMAIGNTIYPQFSTQVE
KGVLFAKGTLLRTGIVLYGFRLTFGDIADVGLNAVVTDAIMLISTFFLTALLGIRYLKMD
KQLVYLTGAGCSICGAAAVMAAEPVTKAESHKVSVAIAVVVIFGTLSIFTYPFFYTWSQH
LINAHQFGIYVGSSVHEVAQVYAIGGNIDPIVANTAVITKMLRVMMLAPFLLMLSWLLTR
SDGVSENTSHKITIPWFAVLFIGVAIFNSFDLLPKELVKLFVKIDSFLLISAMAALGLTT
QASAIKKAGLKPLILGILIYLWLVIGGFLVNYGISKLI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaacactcgtcccttttatttcggacttatatttatcgcgattatcgctatacttgct
aactatttaggaagcaccgacttttcccatcattatcatatcagtgccttaattattgcc
atcttactgggaatggcaatcggcaataccatttacccgcaattttcaacacaagtagaa
aaaggcgtattatttgccaaaggcacgcttcttcgcactggcattgtgctgtatggtttt
cgcctcacttttggcgatattgccgatgttggcttaaatgctgttgtcactgatgccatt
atgctaatttcaaccttttttcttaccgcacttttgggcattcgttatctaaaaatggat
aaacaattggtttatctcactggggcaggatgtagtatttgtggtgcggcagcggttatg
gcggcagagcctgttaccaaagcagaatctcataaagtttcagtggcgattgccgtagtg
gtcattttcgggacgctttctatttttacttatccatttttctacacttggtcacaacat
ttaattaacgctcatcaattcggtatttatgttggctctagcgtgcatgaagtggctcaa
gtttacgctatcgggggaaatattgatcctatcgtggcaaataccgccgtcattaccaaa
atgctccgagtgatgatgcttgcaccatttttattaatgctttcttggttattaacacgt
agtgatggggtatcagaaaatacgtcacacaaaattacaattccttggtttgctgtactt
tttattggcgttgccatttttaattcttttgatttattaccaaaagaactcgtgaaatta
ttcgttaaaatcgattctttcttattaatttcagcgatggctgcacttggcttaactacg
caagcaagcgcaatcaagaaagctggactaaaacctctgattttagggatactgatttat
ttatggctagtgattgggggatttttagtgaactatggaatatcaaaattaatataa

DBGET integrated database retrieval system