KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05925Help
Entry
CGSHiEE_05925     CDS       T00543                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K03841  
fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGSHiEE_05925
   00030 Pentose phosphate pathway
    CGSHiEE_05925
   00051 Fructose and mannose metabolism
    CGSHiEE_05925
  Energy metabolism
   00680 Methane metabolism
    CGSHiEE_05925
Enzymes [BR:hip01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CGSHiEE_05925
Exosome [BR:hip04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CGSHiEE_05925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1177055..1178056
Genome map
AA seq 333 aa AA seqDB search
MKTLSEFIVERQAEYPNAKGELSGILSSIRLLAKIIHRDINKAGLTNILGQSGIENVQGE
SQMKLDLFAHNTMKAALMAREEVAGFASEEEESFIAFDTERGRNAKYIILTDPLDGSSNI
DVNVSVGTIFSIYRRVSPIGSPVTLEDFMQPGNKQVAAGYIVYGSSTMLVYTTGHGVNGF
TYDPSIGTFCLSHENMQMPKEGKIYSINEGQYLKFPQGVKKYIKYCQEEDKATHRPYVSR
YIGSLVADFHRNLLKGGIYIYPSATNYPNGKLRLLYEGNPIAFLAEQAGGVATDGYRRIL
DIEPTALHERVPLFVGSEDMVKKAQEMMEEFKE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattaagtgaatttatcgttgaacgccaagcagaatacccaaatgctaaaggg
gaattgagtggtattttgtcgtcaattcgtcttttagcgaaaattattcatcgagatatt
aacaaagcaggtttaacaaatattctcggtcaatctggtattgaaaatgtacaaggcgaa
agtcaaatgaaactcgatttattcgcccataacacgatgaaagcggcattaatggcacgt
gaagaagtggctggttttgcatctgaagaagaagaaagttttattgcgtttgatacagaa
cgtggccgtaatgcaaaatatattattttaacggatccccttgatggttcttcaaatatt
gatgtaaacgtatctgtaggaacaattttctctatttaccgtcgcgtatctccaattggc
tcacctgttaccttagaagattttatgcaaccaggtaataaacaagtcgcggcgggttat
attgtttatggttcatcaacaatgttggtttataccactggtcacggtgtgaatggtttc
acttatgatccgtctatcggtacattctgtctgtcacacgaaaatatgcaaatgccaaaa
gagggcaaaatttattccatcaatgaaggacaatacctgaaattcccacaaggtgtgaaa
aaatatattaaatattgccaagaagaagataaagcgactcatcgcccttacgtatctcgc
tatattggttcacttgtagcagacttccaccgcaatttattaaaaggcggcatttatatt
tacccaagtgcaaccaactatccaaatggaaaactccgtttattatatgaaggcaatcct
attgcatttttagcggagcaagctggtggtgtcgcaacagatggttatcgtcgaatttta
gatatcgaaccaaccgcacttcatgaacgtgttccactatttgttggttcagaagatatg
gtgaaaaaagcgcaagaaatgatggaagaatttaaagaataa

DBGET integrated database retrieval system