KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05925Help
Entry
CGSHiEE_05925     CDS       T00543                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00010  Glycolysis / Gluconeogenesis
hip00030  Pentose phosphate pathway
hip00051  Fructose and mannose metabolism
hip00680  Methane metabolism
hip01100  Metabolic pathways
hip01110  Biosynthesis of secondary metabolites
hip01120  Microbial metabolism in diverse environments
hip01130  Biosynthesis of antibiotics
hip01200  Carbon metabolism
Module
hip_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGSHiEE_05925
   00030 Pentose phosphate pathway
    CGSHiEE_05925
   00051 Fructose and mannose metabolism
    CGSHiEE_05925
  Energy metabolism
   00680 Methane metabolism
    CGSHiEE_05925
Enzymes [BR:hip01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CGSHiEE_05925
Exosome [BR:hip04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CGSHiEE_05925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-ProteinID: ABQ98542
UniProt: A5UCP1
Position
1177055..1178056
Genome map
AA seq 333 aa AA seqDB search
MKTLSEFIVERQAEYPNAKGELSGILSSIRLLAKIIHRDINKAGLTNILGQSGIENVQGE
SQMKLDLFAHNTMKAALMAREEVAGFASEEEESFIAFDTERGRNAKYIILTDPLDGSSNI
DVNVSVGTIFSIYRRVSPIGSPVTLEDFMQPGNKQVAAGYIVYGSSTMLVYTTGHGVNGF
TYDPSIGTFCLSHENMQMPKEGKIYSINEGQYLKFPQGVKKYIKYCQEEDKATHRPYVSR
YIGSLVADFHRNLLKGGIYIYPSATNYPNGKLRLLYEGNPIAFLAEQAGGVATDGYRRIL
DIEPTALHERVPLFVGSEDMVKKAQEMMEEFKE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattaagtgaatttatcgttgaacgccaagcagaatacccaaatgctaaaggg
gaattgagtggtattttgtcgtcaattcgtcttttagcgaaaattattcatcgagatatt
aacaaagcaggtttaacaaatattctcggtcaatctggtattgaaaatgtacaaggcgaa
agtcaaatgaaactcgatttattcgcccataacacgatgaaagcggcattaatggcacgt
gaagaagtggctggttttgcatctgaagaagaagaaagttttattgcgtttgatacagaa
cgtggccgtaatgcaaaatatattattttaacggatccccttgatggttcttcaaatatt
gatgtaaacgtatctgtaggaacaattttctctatttaccgtcgcgtatctccaattggc
tcacctgttaccttagaagattttatgcaaccaggtaataaacaagtcgcggcgggttat
attgtttatggttcatcaacaatgttggtttataccactggtcacggtgtgaatggtttc
acttatgatccgtctatcggtacattctgtctgtcacacgaaaatatgcaaatgccaaaa
gagggcaaaatttattccatcaatgaaggacaatacctgaaattcccacaaggtgtgaaa
aaatatattaaatattgccaagaagaagataaagcgactcatcgcccttacgtatctcgc
tatattggttcacttgtagcagacttccaccgcaatttattaaaaggcggcatttatatt
tacccaagtgcaaccaactatccaaatggaaaactccgtttattatatgaaggcaatcct
attgcatttttagcggagcaagctggtggtgtcgcaacagatggttatcgtcgaatttta
gatatcgaaccaaccgcacttcatgaacgtgttccactatttgttggttcagaagatatg
gtgaaaaaagcgcaagaaatgatggaagaatttaaagaataa

DBGET integrated database retrieval system