KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05930Help
Entry
CGSHiEE_05930     CDS       T00543                                 

Definition
(GenBank) cytidylate kinase
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytidylate_kin AAA_17 Cytidylate_kin2 AAA_18 AAA_22 dNK APS_kinase AAA AAA_33 ABC_tran TsaE RNA_helicase ADK AAA_29 T2SSE SKI RsgA_GTPase AAA_28 PRK NTPase_1 IstB_IS21 PduV-EutP Rad17 TIP49
Motif
Other DBs
NCBI-ProteinID: ABQ98543
Position
complement(1178091..1178186)
Genome map
AA seq 31 aa AA seqDB search
MGMIITVDGPSGAGKGTLCYALAEKLGYAFY
NT seq 96 nt NT seq  +upstreamnt  +downstreamnt
atgggaatgattattactgttgatggtcctagtggtgctgggaaagggacgctttgttat
gcgttggctgaaaagttgggctatgctttttattga

DBGET integrated database retrieval system