KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05935Help
Entry
CGSHiEE_05935     CDS       T00543                                 

Definition
(GenBank) putative L-lactate permease
  KO
K03303  
lactate permease
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
Transporters [BR:hip02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   CGSHiEE_05935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1178460..1180058
Genome map
AA seq 532 aa AA seqDB search
MLSFVLSIFPIVLLIYLMVKRNALPSYVALPWIATLVMGVHLLHFNTDIVTISANVVSAI
IAVQTPITVIFGAILFNRFSEISGATNIMRKWLGNINPNPVAQLMIIGWAFAFMIEGASG
FGTPAAIAAPILVGLGFHPLKVAMLALIMNSVPVSFGAVGTPTWFGFGALKLSENMILEI
GSITAFIHSIAALLIPLLALRILVSWDDIRKNIVFIYISVLGCVVPYFLIAQVNYEFPSL
VGGAIGLFISVWAANRNIGLAKVTNTLDNNAVSTGEVVKALFPTGLLIAFLIVTRIHQLP
FKAMMNDATIWFSTTLGSLGLFEISKGLIFSLKNIFGSNVSSSYKLLYVPALIPFVITVL
IAIPVFKISSSNVKQIFVSSLQQSKNPFIALVGALVMVNLMLVGGEHSMVKIIGRTFAEI
SGSNWTIFSSFLGAIGSFFSGSNTVSNLTFGSVQLSTAETTGISVALVLALQSVGGAMGN
MVCINNIVAVSSVLNISNQEGTIIKKTIIPMIIYGIIAALGALFLVPLFYNL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcttttgttctaagtatttttcctatcgttttactgatttatcttatggtaaaa
agaaacgcgctaccttcttatgttgccttaccttggattgcgacattagttatgggcgtt
catcttttacactttaatacagatattgtcactattagtgcaaatgttgtttctgcaatt
attgcggtacaaacacctattacagtaatttttggtgcgattctctttaaccgtttctct
gaaatttcaggcgcaacaaatattatgcgaaaatggctaggaaatattaatccaaatcct
gttgcacaattaatgattattggttgggcatttgcctttatgatcgagggggcaagtggt
tttggtacaccagcggcaattgctgcacctattttagtgggattaggttttcatccatta
aaagtggcgatgttggcactgattatgaactcagttcccgtatcctttggtgcggtaggt
acaccaacttggtttggttttggtgctttaaaattatcagaaaatatgattttagaaatt
gggtctattacagcatttatccactccattgctgcacttcttatcccattattagcactt
cgtatcttagtaagttgggatgatattcgtaaaaacatcgtatttatttatattagcgta
ctaggttgcgtagtaccttatttcttaattgctcaagtcaattacgaatttccatcactc
gttgggggggcaatcggcttatttatttccgtatgggctgcgaatcgcaatattggttta
gcaaaagtaacaaatacccttgataataatgcggtaagtacgggagaagtagttaaagca
ttattccctacaggtttacttattgcatttttaattgtgactcgtattcatcaattacca
ttcaaagcaatgatgaatgacgcaactatttggttctcaaccacattaggttcgttagga
ttatttgaaattagcaaaggtttaatctttagcttaaaaaatatttttggctcaaatgtt
tcatcaagctataaacttctttacgtacctgcattgattccatttgtcattacagtacta
attgcgattcctgtctttaaaatttccagttcaaatgttaaacagatttttgtatcaagt
ttacaacaatctaaaaatccatttattgccttagttggtgccttagtgatggtaaaccta
atgttagtgggtggcgaacattctatggtaaaaattataggtagaacttttgctgaaatt
tctggtagtaactggactattttctcctctttcttaggcgcgattggatcctttttctca
ggttcaaataccgtatccaacctaacatttggtagtgttcaactttctaccgcagaaaca
acaggcatttctgtcgcacttgttcttgctttacaatctgttggtggggcaatggggaat
atggtatgtataaataacattgtagcggtaagttcagtgttaaatatttcaaaccaagaa
ggcacaattattaagaaaaccattatacctatgatcatttacggtatcattgccgcactt
ggcgcactgttcttagtacctttattttataatctataa

DBGET integrated database retrieval system