KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06050Help
Entry
CGSHiEE_06050     CDS       T00543                                 

Definition
(GenBank) hypothetical protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sua5_yciO_yrdC
Motif
Other DBs
NCBI-ProteinID: ABQ98563
Position
complement(1202754..1203377)
Genome map
AA seq 207 aa AA seqDB search
MSQFFYIHPENPQVRLINQAVEILQKGGVIVYPTDSGYALGCMMGDKHAMDRIVAIRKLP
EGHNFTLVCSDLSELSTYARVNNTAYRLIKNNTPGRYTFILTATKELPRRLMTSKRKTIG
LRVPDNKIALDLLSALGEPILSCSLMLPGEEHTTQSDPEEIRDRLEHQVDLIIHGGYLGQ
EPTTVVDLTEESPVILREGSGSTAPFI
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagccaatttttctatatccaccctgaaaatccacaagtgcgcttgattaatcaagcc
gtagagattttacaaaaaggcggtgtgattgtgtatccaacggattcgggatatgccttg
ggctgtatgatgggcgataaacacgcaatggatcgcattgtagcaattcgtaaattgcct
gaaggacataattttaccttggtgtgtagcgatttgtcggaactttcaacctatgcaagg
gtaaataataccgcttatcgtttgattaaaaataatacgccagggcgttatacttttatt
cttacagcaacgaaagaattacctcgccgtttaatgacatcaaaacgtaaaaccattggt
ttacgcgtaccagataataaaattgctttagatttgctttcagccttaggtgagccgatt
ttatcttgttcgttaatgttgccaggtgaagaacataccacgcaatccgatcctgaagaa
attcgtgatcgtttggaacaccaagtggatttaattattcatggtggatatttagggcaa
gagcctacaacagtggtggatttaacggaagaatcgccagtgattttacgcgaaggaagt
ggaagtactgctccttttatttaa

DBGET integrated database retrieval system