KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06140Help
Entry
CGSHiEE_06140     CDS       T00543                                 

Gene name
gmhA
Definition
(GenBank) phosphoheptose isomerase
  KO
K03271  
D-sedoheptulose 7-phosphate isomerase [EC:5.3.1.28]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CGSHiEE_06140 (gmhA)
Enzymes [BR:hip01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.28  D-sedoheptulose 7-phosphate isomerase
     CGSHiEE_06140 (gmhA)
Lipopolysaccharide biosynthesis proteins [BR:hip01005]
 Unusual sugar
  CGSHiEE_06140 (gmhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1218979..1219563
Genome map
AA seq 194 aa AA seqDB search
MYLDQIKAELVEAQDLLNKFISDENNIKLIQEAALLISNSFKQGGKVLSCGNGGSHCDAM
HFAEELTGRYRENRPGYPAIAISDASHLSCVSNDFGYEYVFSRYVEAVGQKGDVLFGLST
SGNSKNILNAIEAAKTKGMKVIAMTGKDGGKMAGLADVEIRIPHFRYADRIQEIHIKVIH
ILMMLIEFEMAKQA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtatttagatcaaatcaaagcagaacttgtggaagcacaagatttgttaaacaaattt
atttctgacgaaaataacattaaattaattcaagaagcggcattattaatttcgaatagc
ttcaaacaaggaggcaaagtgctttcttgtggtaatggcggttcgcactgtgatgcgatg
cattttgcagaagaattaacgggtcgttatcgtgaaaatcgcccaggttatcctgctatt
gcgatttcagatgcaagccatttaagctgtgtaagtaatgattttggttatgaatatgtc
ttttctcgctatgttgaagcggtggggcaaaaaggcgatgtattattcggtttatcaacc
tctggtaattcaaaaaatattttaaacgccattgaagcggcaaaaacaaaaggcatgaaa
gtgattgcgatgacaggcaaagatggcggaaaaatggcaggattagcggatgttgaaatt
cgcataccccatttccgttatgcagatcgtattcaagaaatccatatcaaagttattcat
attttaatgatgttaattgagtttgaaatggcaaaacaagcctaa

DBGET integrated database retrieval system