KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06145Help
Entry
CGSHiEE_06145     CDS       T00543                                 

Definition
(GenBank) arginine transport ATP-binding protein
  KO
K10000  
arginine transport system ATP-binding protein [EC:3.6.3.-]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
ABC transporters
Module
Arginine transport system
Brite
KEGG Orthology (KO) [BR:hip00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CGSHiEE_06145
Enzymes [BR:hip01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     CGSHiEE_06145
Transporters [BR:hip02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Arginine transporter [MD:M00229] [OT]
    CGSHiEE_06145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1219689..1220420
Genome map
AA seq 243 aa AA seqDB search
MAIRVKNLNFFYGSSQTLFDINLEAEEGDTVVLLGPSGAGKSTLIRTLNLLEVPKSGELS
IANNDFNLSNAMANPKAIRQLRQDVGMVFQQYHLWPHLTVIENLIEAPMKVRGVSESEAK
TDAMELLKRLRLEQLADRFPLHLSGGQQQRVAIARALMMKPQVLLFDEPTAALDPEITAQ
VVDIIKELQETGITQVIVTHEVNVAQKVATKVVYMEQGKIVEMGSADCFENPKTEQFKHY
LSH
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctattcgtgttaaaaatctcaatttcttttacggttcatcacaaacgttatttgat
attaaccttgaagcagaagaaggcgataccgttgtgttgctgggcccaagtggtgcaggc
aaaagtacattaattcgcacattaaatttgttagaagtgccaaagtctggtgaattaagt
attgcaaataatgattttaatttatccaatgcaatggcaaatcccaaagcaatccgacaa
ttacgtcaagatgtaggaatggtttttcaacaatatcatctttggccgcacttaacggta
attgaaaacctaattgaagcaccaatgaaagtgcgtggagtgagtgaaagtgaagcgaaa
accgatgcaatggaattgttaaaacgtttacgtttagaacaacttgccgatcgctttcca
ttgcatttatcaggcggtcagcaacaacgtgttgcaatagcgcgcgcactaatgatgaag
ccacaagttctattatttgatgaaccaacggctgcgctagatccagaaattacagcgcaa
gttgtagatattattaaagaattacaagaaactggcattacgcaagtgattgtgacccac
gaagtcaatgtggcacaaaaagtggcgacaaaagtcgtctatatggaacaaggtaaaatc
gtcgaaatgggatcggctgattgctttgaaaatccaaaaacggaacaatttaaacactat
ctttctcactag

DBGET integrated database retrieval system