KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06155Help
Entry
CGSHiEE_06155     CDS       T00543                                 

Definition
(GenBank) arginine transporter permease subunit ArtQ
  KO
K09999  arginine transport system permease protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip02010  ABC transporters
Module
hip_M00229  Arginine transport system
Brite
KEGG Orthology (KO) [BR:hip00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CGSHiEE_06155
Transporters [BR:hip02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Arginine transporter [MD:M00229] [OT]
    CGSHiEE_06155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABQ98582
Position
1221161..1221826
Genome map
AA seq 221 aa AA seqDB search
MFSDFLSLMFTAALMTLGLAVCSLLLGLFLSLIFAVLEANRFVGKPMTVFVALLRGLPEI
IVVLLVYFGSTELVEMLTGEYIEFGAFGCGVFALSLIFAAYASQTLRGAIQAIPKGQWES
GAALGLSKSYTFIHIVMPQVWRHALPGLSNQWLVLLKDTALVSLIGVDDLMRQADLINTN
THQPFTWYGIAALIYLAVTLISQVGIQKLELRFTRFERGVK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttttctgactttctttctttaatgtttaccgctgctctaatgactttagggcttgcg
gtctgttcattgctcttaggcttatttttaagccttatttttgccgtgcttgaagcaaat
cgctttgttggcaagccgatgacagtatttgtggcattattacgtggcttacccgaaatt
attgttgtattacttgtctattttggttctactgaattagtagaaatgctgacaggagaa
tacattgaatttggggcatttggctgtggtgtgtttgcgctttctctcatttttgcagct
tatgcttcacaaacattacgcggcgcaattcaagctattccgaaaggtcaatgggaatct
ggtgcggcgttaggcttaagcaaaagctatacgttcattcatattgttatgccacaagta
tggcgtcacgccttacctggtttaagcaaccaatggcttgtattgctaaaagatacggca
ttggtttcattaattggtgtggacgatttgatgcgccaagcggatctgattaataccaac
acccatcagccttttacttggtatggtattgctgcgttaatttatttggcagtgacatta
attagccaagttggtattcaaaaattagagctgcgttttactcgttttgaaaggggcgtg
aaataa

DBGET integrated database retrieval system