KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06170Help
Entry
CGSHiEE_06170     CDS       T00543                                 

Gene name
artM
Definition
(GenBank) arginine transporter permease subunit ArtM
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1223124..1223636)
Genome map
AA seq 170 aa AA seqDB search
MKKSLLAVIVGAFAFASVANANIYAEGDIGLSQTKANGSNNTRVEPRVSVGYKVGNTRVA
GDYTHHGKVDGTKIQGLGASVLYDFDTNSKVQPYVGARVATNQFKYTNRAEQKFKSSSDI
KLGYGVVAGAKYKLDGNWYANGGVEYNRLGNFDSTKVNNYGAKVGVGYGF
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatctttattagcagttattgtgggtgcatttgcctttgcttctgttgcaaat
gcgaatatctatgctgagggcgatatcggtttatctcaaactaaagcaaacggtagtaac
aatacaagagttgaacctcgcgtatccgtgggttataaagtaggaaatacacgtgttgcg
ggtgattatactcatcatggaaaagttgatggcacaaaaattcaaggtttaggtgcatca
gtattatatgattttgacacgaattctaaagtgcaaccttatgttggtgctcgtgtagcg
actaatcaatttaaatacaccaatcgcgcagaacaaaagtttaaaagttcttctgatatt
aagctcggatatggggttgtagcaggtgcaaaatataagttagatggcaactggtacgca
aatggtggagttgagtacaatcgtttaggtaattttgatagtaccaaagttaataactat
ggtgcaaaagttggtgtggggtacggattctaa

DBGET integrated database retrieval system