KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06225Help
Entry
CGSHiEE_06225     CDS       T00543                                 

Definition
(GenBank) Outer membrane protein P5
  KO
K03286  
OmpA-OmpF porin, OOP family
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
Transporters [BR:hip02000]
 Other Transporters
  Pores ion channels [TC:1]
   CGSHiEE_06225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1231310..1232026)
Genome map
AA seq 238 aa AA seqDB search
MLDGLDVYGKAGVALVRSDYKFYEDANGTRNHKEGRHTARASGLFAVGAEYAVLPELAVR
LEYQWLTRVGKYRPQDNPNTAINYNPWIGSINAGISYRFGQGAAPVVAAPEVVSKTFSLN
SDVTFAFGKANLKPQAQATLDSIYGEMSQVKSAKVAVAGYTDRIGSDAFNVKLSQERADS
VANYFVAKGVAADAISATGYGKANPVTGATCDQVKGRKALIACLAPDRRVEIAVNGTK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
gtgttagacggtttagatgtttatggcaaagcaggtgttgctttagtacgttctgattat
aaattttatgaagatgcaaacggtactcgtaaccacaaggaaggtcgtcacacagcacgt
gcctctggtttatttgcagtaggtgcagaatacgcagtattaccagaattagcagttcgt
ttagaataccaatggctaactcgcgtaggtaaataccgccctcaagataacccaaatacc
gcaattaactacaacccttggattggttctatcaatgcgggtatttcttaccgtttcggt
caaggcgcagcgccagttgtagcagcacctgaagttgtaagcaaaactttcagcttaaac
tctgatgtaactttcgcatttggtaaagcaaacttaaaacctcaagcacaagcaacatta
gacagcatctatggcgaaatgtcacaagttaaaagtgcaaaagtagctgttgctggttac
actgaccgtattggttctgatgcgttcaacgtaaaactttctcaagaacgtgcagattca
gtagctaactactttgttgctaaaggtgttgcagcagacgcaatctctgcaactggctac
ggtaaagcaaacccagtaactggtgcaacttgtgaccaagttaaaggtcgtaaagcgctt
atcgcttgtcttgctccagaccgtcgtgtagaaatcgcagtaaacggtactaaataa

DBGET integrated database retrieval system