KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06255Help
Entry
CGSHiEE_06255     CDS       T00543                                 

Definition
(GenBank) cysteine/glutathione ABC transporter membrane/ATP-binding component
  KO
K16013  
ATP-binding cassette, subfamily C, bacterial CydD
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:hip00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CGSHiEE_06255
Transporters [BR:hip02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    CGSHiEE_06255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1239298..1241058
Genome map
AA seq 586 aa AA seqDB search
MNKLRQKYLQKWLRAQQEPIKKLMRANIVLATLSSFILVMQTYFLATLLDKLIMQNVPRD
ELIPYFLGLIIGFGIRAIILWAREKIGFQSGQLLRNHIRQKILDKIHLVGPATINQKPAG
SWASIMLEQVENLHNFYARFLPQQSLSAIVPVVIFIAVFPLNWAAGLILMITAPLVPLFM
IIVGIAAADNSQKNMDTLSRLSAQFLDRLRGLETLRLFNRTSEQTEHIENATEDFRETTM
DVLKLAFLSSAVLEFFTSISIALMAVYFGFSYLGQIEFGTYNAPLTLFTGFFCLILAPEF
YQPLRDLGTYYHDRAAGIGAADAIVDFLESDYLTVHQNEKTISLESAVEISAENLVVLST
QGSALTKPLNFQIPANHNVALVGQSGAGKTSLINAILGFLPYEGSLKINGQELRESNLAD
WRKHITWVGQNPLLLQGTIKENLLLGNIQANDEEINQALMRSQAKEFTDKLGLHHEIKDG
GLGISVGQAQRLAIARALLRKGDLLLLDEPTASLDAQSENLVLQALNEASQHQTTLMITH
RIEDLKQCDQIFVMQRGEIVQQGKFTELQHQGFFAELLAQRQQDIQ
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacttcgccaaaaatatttacaaaaatggcttcgcgcacaacaagaacctatc
aaaaaattaatgcgtgcaaacattgtcttagctacgctttcttcattcattttagtcatg
caaacttattttcttgcgacgttgctcgataaactgattatgcaaaatgtgcctcgtgat
gaacttattccttattttctcgggctaattatcggcttcgggatacgtgctattatttta
tgggcacgcgaaaaaataggtttccaaagcggacaattattacgcaaccatattcgtcaa
aaaattctggataaaattcatcttgtcggccctgcgacaatcaatcaaaaaccagctgga
agttgggcaagcattatgttggaacaagttgaaaacttacataatttctatgcccgtttt
ctgcctcaacaaagtctttcagccattgttccagtggttattttcattgctgtatttccc
ttgaactgggctgcaggcttaatcttaatgattaccgcaccgcttgttcctctgtttatg
atcattgtcggtattgctgcggctgacaacagccaaaaaaatatggataccctttctcgc
ctcagtgcccaatttttagatcgcttacgcggtttggaaaccttgcgtctttttaaccgc
acttctgaacaaactgagcatattgaaaatgccactgaagatttccgtgaaaccacaatg
gatgtgctaaaactcgcttttctctcttctgcagtattggaattttttacctctatttcc
attgcactgatggcggtctattttggttttagctacttaggtcaaattgaatttggtacc
tataatgcaccgcttacacttttcacaggtttcttttgtttaattcttgcacctgaattt
tatcaacccttacgcgatctaggcacctattaccacgaccgtgcagcaggtattggtgca
gcggatgccattgttgattttttagaatctgattatttaactgtacatcaaaatgaaaaa
acaatttctttagaaagtgcggttgaaatttctgccgaaaatttagtggtgctttcgaca
cagggttcagcattaaccaagccgttaaacttccaaattccagcaaatcataatgttgcg
cttgtaggacaaagtggcgcgggaaaaacttcattaataaatgcgattctgggcttttta
ccttatgagggctcgctcaaaattaatgggcaagaacttcgcgaaagtaatctagctgac
tggcgcaaacatattacgtgggtaggacaaaatccattgttattacaaggcacaattaaa
gaaaacttactacttggcaatattcaagccaacgatgaagaaattaatcaagctttaatg
cgttctcaagcgaaagaatttaccgataaacttggacttcatcacgaaataaaagatggt
ggattaggcatttctgtgggacaagcgcaacgccttgccattgctcgggcattgttacgc
aaaggcgatttacttctgctcgatgagccaaccgcaagcctagatgcgcaatcagaaaat
cttgttttacaagcattgaatgaagcaagtcagcatcaaactacactgatgattacacac
cgaattgaagatttgaaacaatgtgatcaaatttttgtgatgcaacgaggagaaatagta
cagcaaggtaaatttaccgaattacaacatcaaggtttctttgctgaactactcgctcaa
cgacaacaggatatccaataa

DBGET integrated database retrieval system