KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06295Help
Entry
CGSHiEE_06295     CDS       T00543                                 

Definition
(GenBank) hypothetical protein
  KO
K11719  lipopolysaccharide export system protein LptC
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
Transporters [BR:hip02000]
 Other Transporters
  Pores ion channels [TC:1]
   CGSHiEE_06295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LptC
Motif
Other DBs
NCBI-ProteinID: ABQ98608
Position
1248011..1248625
Genome map
AA seq 204 aa AA seqDB search
MNIRWNVILGVIALCALAWFYSLNQETADLSELVKKPDSPDYVGYKMETTVFFPDGKKQY
LALSDKIEHYTVDEQTLFTAPLVYLYPTTSNEKEEEKNANQNVDFFSTQSWKLSANQARL
TKDQILYLEGNVVAQNLTSDSRLQRIETESAVVNLKTQDMTSETQVKIKGKNFSSTGLKL
VGNLRQQVATLKEQVKTYYEVSKQ
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcgttggaatgtaattttgggcgttatcgcactttgtgctttggcgtggttt
tattccttaaatcaggaaaccgcagatttatctgaactggtgaaaaagccagatagtcct
gattatgtgggttataaaatggaaactacggtttttttccctgatggtaaaaaacaatat
ttggctttatccgataaaattgagcattatacagtcgatgaacaaaccctttttaccgcg
cctttagtttatttatatcccacaacatcaaatgaaaaggaagaggaaaaaaatgccaat
caaaatgtagatttttttagcacacaaagctggaaattaagtgcaaatcaagcaagattg
acaaaagatcaaatattgtatttagagggtaatgtcgtcgcgcaaaatttaacatcagat
tcacgtttgcaacgcattgaaacagaatcagcggtcgtcaatttgaaaacacaggatatg
acttccgaaacacaggttaaaattaagggtaaaaattttagttctacaggattaaaatta
gtcggaaatttacgccaacaagtggcgacattaaaggaacaggtaaaaacatattatgaa
gttagtaagcaataa

DBGET integrated database retrieval system