KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06330Help
Entry
CGSHiEE_06330     CDS       T00543                                 

Definition
(GenBank) cell division protein FtsZ
  KO
K03531  
cell division protein FtsZ
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
Chromosome [BR:hip03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    CGSHiEE_06330
Cytoskeleton proteins [BR:hip04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   CGSHiEE_06330
Prokaryotic defense system [BR:hip02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    CGSHiEE_06330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1253511..1254776)
Genome map
AA seq 421 aa AA seqDB search
MLYPEYPEYDNFNESGALIKVVGVGGGGGNAVNHMVMNMVKQEMGGTFVGESSLTSEEHG
RIVFYAVNTDAQALRKSQVQQTVQIGGETTKGLGAGANPNIGRKAAEDDQDEIRKMLEGA
DMVFIAAGMGGGTGTGAAPVVAKIAKELGILTVAVVTKPFAFEGKKRMQFAELGIKDLSQ
YVDSMIIIPNQQIQKVLPKNAKLIDAFAAANDVLRNSVMGISDMITSPGLINVDFADVRT
VMSVQGQAMIGFGSAVGEPGAGRAEEAARLAVRNDLLEKIDLSNAQGILVNITAGMDLVF
EEFNIIGETIGSFASEEATVVVGTSLVPEMSDEIRVTIVATGLGEIAGNEPIQVVRQGLS
TQNIEGEGRVNIVPELHRRESVEVSRTASEEYQRPLDKPITDRLEAFKKNNFFNPAQREE
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgctatacccagagtaccctgagtacgataattttaacgaatccggcgcactgatcaaa
gtcgtaggtgtaggcggtggcggtggcaatgccgtaaaccatatggtaatgaatatggta
aaacaagaaatgggcggaacctttgttggcgaaagttcattaacatcagaggaacacggt
cgcatagtattttatgccgtcaatactgatgctcaagcattgcgtaaaagtcaagttcaa
cagaccgtacaaattggtggagaaacaaccaaaggtttaggtgctggggcaaatccgaat
attggtcgtaaggcagctgaagatgatcaggatgaaatccgcaaaatgcttgaaggtgcc
gatatggtctttattgcagcaggtatgggcggcggcacaggtacgggtgcggcacctgtt
gttgctaaaattgctaaagaactcggtattttgactgttgctgtagtgactaaacctttt
gcctttgaaggcaaaaaacgtatgcaatttgcagagcttggtattaaagatttatcccaa
tatgttgattcaatgattattattccgaatcaacaaatccaaaaagttctccctaaaaat
gctaaattaattgatgcttttgctgctgcaaacgacgtattgcgtaattctgtaatggga
atttcagatatgattacctctcctggtttaattaacgtggacttcgctgatgtaagaacg
gtaatgtcagttcaagggcaagctatgattggttttggttcagctgtgggagaacccggt
gcaggtagagcagaagaggcagctcgtcttgcagtacgcaatgatcttctagaaaaaatc
gatctttctaacgctcaaggaattttagttaatattactgctggaatggatttagttttt
gaagagtttaacattataggtgagacaataggtagttttgcttctgaagaagcgacagtt
gttgttggtacgagtttagtgcctgagatgagcgatgaaattcgtgtaactattgtggca
actggtctcggtgaaattgcaggaaatgaaccaattcaggttgttcgtcaagggctttct
acgcagaatattgaaggtgaaggacgtgtaaacattgttcctgaacttcatcgtcgtgaa
tctgttgaagtgtcaagaactgcatcagaagaatatcaacggccgttagataaaccgatt
acagatcgcttggaagcatttaagaaaaataatttctttaatcctgcacagcgtgaagaa
aattaa

DBGET integrated database retrieval system