KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06370Help
Entry
CGSHiEE_06370     CDS       T00543                                 

Gene name
murD
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase (EC:6.3.2.9)
Orthology
K01925  
UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
D-Glutamine and D-glutamate metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CGSHiEE_06370 (murD)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CGSHiEE_06370 (murD)
Enzymes [BR:hip01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     CGSHiEE_06370 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1261751..1263064)
Genome map
AA seq 437 aa AA seqDB search
MNAYQNKNITIIGLGKTGLSCVDYLLSQQANIRVIDTRKKPTGIDKLPQNIPLHTGSLNQ
EWLLESDMIVISPGLAVKTPEIQTALKAGVEVIGDIELFCRAATKPIVGITGSNGKSTVT
TLVYEMAKAAGVKVGMGGNIGIPALSLLNEDCELYVLELSSFQLETTYSLKAAAATVLNV
TEDHMDRYMDLEDYRQAKLRIYHNAEVGVLNNEDKLTFGEGENQARQTVSFAENSADYWL
KTENGKQYLMVKDEVILPCEEATLVGRHNYMNILAATALAQAVGINLDAIRTALRHFKGL
DHRFQLAHQANGVRWINDSKATNVGSTVAALSGLYVEGKLHLLLGGDGKGADFSELAELI
NQPHIICYCFGRDGALLAKLSSQSYLFETMEQAIAFLRPTLQSGDMVLLSPACASLDQFA
SFEKRGEEFTRLAQCLA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcctatcaaaacaaaaatattacgatcattgggcttggcaaaacaggtctttct
tgtgtggattatctcttatcccaacaggctaatattcgtgtgattgatacccgaaaaaag
cctactggtattgataaacttcctcaaaatatccctcttcatactggtagtttaaatcag
gaatggttacttgaaagcgatatgattgttattagcccagggcttgcggtaaaaacacca
gaaattcaaaccgcacttaaagcgggagtggaagtaatcggcgatattgaattattctgc
cgcgcagcgacaaagccaattgtggggattacaggttcaaatggaaaaagtactgttact
actttagtttatgaaatggcgaaagctgctggcgtgaaagttggtatgggcggaaatatt
gggattcccgctttgtcattgttgaatgaagattgtgaactttatgtactagagctttct
agttttcagcttgagacaacttatagcttaaaagctgcggctgcgactgttttgaacgtg
actgaagatcatatggatcgctatatggatttagaagattatcgccaagcaaaattacgc
atttatcataatgctgaggtcggagttttgaataatgaggataagctgacttttggtgaa
ggtgaaaatcaagcgagacaaaccgtttcttttgcggaaaatagtgcggattattggcta
aaaactgaaaatggcaagcaatacttaatggtaaaagatgaagtaattttaccttgtgaa
gaagccacattggtgggtcgccataattatatgaacattttggcagcaacagcattggca
caagctgtcggtattaatttagatgcaattcgtaccgcacttcgtcatttcaaaggatta
gatcatcgtttccaattagcgcatcaagccaatggtgttcgttggattaatgattctaaa
gcgacaaatgtaggcagcactgttgctgcattgtctgggctttatgttgagggtaaattg
catttgttgctaggtggagacggaaaaggggctgatttttcagaattagctgaattaatt
aatcaaccacatattatttgttattgttttggtcgagatggtgcgttgcttgcaaaactt
tcatcacaaagctatttgtttgaaacaatggaacaagccatagcgtttttacgtccaaca
ttgcaaagcggagatatggtattattgtcgcctgcttgtgcaagtctcgatcagtttgct
tcttttgaaaaacgcggcgaagaatttacgcgtttagctcaatgtttagcctaa

DBGET integrated database retrieval system