KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06370Help
Entry
CGSHiEE_06370     CDS       T00543                                 

Gene name
murD
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase (EC:6.3.2.9)
Orthology
K01925  
UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
D-Glutamine and D-glutamate metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:hip00471]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hip00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1261751..1263064)
Genome map
AA seq 437 aa AA seqDB search
MNAYQNKNITIIGLGKTGLSCVDYLLSQQANIRVIDTRKKPTGIDKLPQNIPLHTGSLNQ
EWLLESDMIVISPGLAVKTPEIQTALKAGVEVIGDIELFCRAATKPIVGITGSNGKSTVT
TLVYEMAKAAGVKVGMGGNIGIPALSLLNEDCELYVLELSSFQLETTYSLKAAAATVLNV
TEDHMDRYMDLEDYRQAKLRIYHNAEVGVLNNEDKLTFGEGENQARQTVSFAENSADYWL
KTENGKQYLMVKDEVILPCEEATLVGRHNYMNILAATALAQAVGINLDAIRTALRHFKGL
DHRFQLAHQANGVRWINDSKATNVGSTVAALSGLYVEGKLHLLLGGDGKGADFSELAELI
NQPHIICYCFGRDGALLAKLSSQSYLFETMEQAIAFLRPTLQSGDMVLLSPACASLDQFA
SFEKRGEEFTRLAQCLA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcctatcaaaacaaaaatattacgatcattgggcttggcaaaacaggtctttct
tgtgtggattatctcttatcccaacaggctaatattcgtgtgattgatacccgaaaaaag
cctactggtattgataaacttcctcaaaatatccctcttcatactggtagtttaaatcag
gaatggttacttgaaagcgatatgattgttattagcccagggcttgcggtaaaaacacca
gaaattcaaaccgcacttaaagcgggagtggaagtaatcggcgatattgaattattctgc
cgcgcagcgacaaagccaattgtggggattacaggttcaaatggaaaaagtactgttact
actttagtttatgaaatggcgaaagctgctggcgtgaaagttggtatgggcggaaatatt
gggattcccgctttgtcattgttgaatgaagattgtgaactttatgtactagagctttct
agttttcagcttgagacaacttatagcttaaaagctgcggctgcgactgttttgaacgtg
actgaagatcatatggatcgctatatggatttagaagattatcgccaagcaaaattacgc
atttatcataatgctgaggtcggagttttgaataatgaggataagctgacttttggtgaa
ggtgaaaatcaagcgagacaaaccgtttcttttgcggaaaatagtgcggattattggcta
aaaactgaaaatggcaagcaatacttaatggtaaaagatgaagtaattttaccttgtgaa
gaagccacattggtgggtcgccataattatatgaacattttggcagcaacagcattggca
caagctgtcggtattaatttagatgcaattcgtaccgcacttcgtcatttcaaaggatta
gatcatcgtttccaattagcgcatcaagccaatggtgttcgttggattaatgattctaaa
gcgacaaatgtaggcagcactgttgctgcattgtctgggctttatgttgagggtaaattg
catttgttgctaggtggagacggaaaaggggctgatttttcagaattagctgaattaatt
aatcaaccacatattatttgttattgttttggtcgagatggtgcgttgcttgcaaaactt
tcatcacaaagctatttgtttgaaacaatggaacaagccatagcgtttttacgtccaaca
ttgcaaagcggagatatggtattattgtcgcctgcttgtgcaagtctcgatcagtttgct
tcttttgaaaaacgcggcgaagaatttacgcgtttagctcaatgtttagcctaa

DBGET integrated database retrieval system