KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06425Help
Entry
CGSHiEE_06425     CDS       T00543                                 

Definition
(GenBank) transaldolase B
  KO
K15580  oligopeptide transport system substrate-binding protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip01501  beta-Lactam resistance
hip02010  ABC transporters
hip02024  Quorum sensing
Module
hip_M00439  Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:hip00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CGSHiEE_06425
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    CGSHiEE_06425
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CGSHiEE_06425
Transporters [BR:hip02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    CGSHiEE_06425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: ABQ98632
Position
1274849..1276486
Genome map
AA seq 545 aa AA seqDB search
MQHKLLFSAIALALSYSAQAVIVPEGTQLDEKQHIVFNNGAEPQSFDPHKTEGVPESNVA
YQLLEGLVTSDSEGKLQPGVAESWENTPDFKTWTFHLRKDAKWSNGDPVTAHDFVFAWRR
LVDPATAAPYASYLSYLQVENAQDIIDGKKKPAELGVEAKDDYTFVVHATNPVPYAVSLT
THQSLLPLPQKVVEKLGDAWVKKENYVGNGAYKLANHIINEKIEFERNPLYWNDKETVIN
SATFLAIENPSTDVARYRAGDLDMTSYGLPPEQFAKLQKELPGEVYVTRTLGTYSYELNN
KKAPFDNVNIRKALNLSLDRHVITDKVLGQGQTPTYVFTPTYIEEGHLIQQPAYSKEPMA
QRNEEAIKLLEEAGYSKANPLKFSILYNTNENHKKVAIAAASMWKANTKGLIDVKLENQE
WKTYIDSRRAGRYDAARAGWSADYNQATTFGNYFLSNSSNNTAKYANPEYDKAMAESYAA
TDAEGRAEGRAKAYAKAEEILAKDYGIVPIFNYVNPRLVKPYVKGYSGKDPQDHIYLRNL
YIIKH
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacaaactactcttctctgcaatcgctcttgctctttcctattctgcgcaagca
gttatagtgcctgaaggaacacaattagatgaaaaacagcatatcgtgttcaataatggg
gctgaaccacaaagttttgacccacacaaaaccgaaggtgtgccagaatccaacgttgct
tatcaattacttgaaggcttagtcacctcagactctgaaggtaaacttcaaccgggtgtg
gctgaaagctgggaaaatacacctgacttcaaaacctggacattccatttacgtaaagat
gctaaatggtcaaacggagatcctgttactgcacatgatttcgtgtttgcgtggcgtcgt
ttagtggatcctgcaactgctgcaccttacgcgagttacctaagttatttacaagttgaa
aatgcacaagacattattgacggtaagaaaaaaccggctgaattaggcgtggaagcaaaa
gatgattacacctttgtggttcatgcaaccaatcctgtgccttatgcagtcagtttaacg
actcaccaatccttattgccattaccacaaaaagtagtcgaaaaattgggtgatgcatgg
gtgaaaaaagaaaactacgtgggtaacggtgcttataagttggctaaccacatcattaac
gaaaaaatcgaatttgaacgtaacccactttattggaacgataaagaaaccgtaatcaat
agcgcgacattcctcgccattgaaaacccaagtaccgatgtagcgcgttatcgtgcgggc
gatttagacatgaccagttatggtttaccgccagaacaattcgctaaattacaaaaagaa
ttgccaggcgaagtatacgttactcgtaccctaggaacttattcttatgaattaaacaat
aagaaagcaccttttgataacgtgaatattcgtaaagccttgaacttatcccttgatcgt
catgtgatcacagataaagtattgggccaaggtcaaacaccaacctatgtgtttactcca
acttacatcgaagaaggccatctcattcaacaacctgcttattcaaaagaaccgatggca
caacgtaatgaagaagccattaaactcttagaagaagctggttacagtaaagcgaatccg
ttgaaattcagcattctttataataccaatgaaaaccacaaaaaagtggctattgctgca
gcttctatgtggaaagcgaacaccaaaggtttgattgatgtgaaattagaaaaccaagag
tggaaaacttacattgatagccgtcgtgcaggtcgttacgatgcggcacgtgcaggatgg
agtgcggattacaaccaagcaacaacattcggcaactatttcttatctaattctagtaac
aatactgcgaaatacgcgaatccagaatatgataaagcgatggcagaatcttacgcagca
actgatgcagaaggtcgtgcagaaggtcgtgcaaaagcttatgcgaaagctgaagaaatt
cttgcaaaagattacggtatcgtaccaatctttaactatgtaaatccacgcttagtgaaa
ccttacgtaaaaggttattcaggcaaagatccgcaagatcacatctacttacgaaacctt
tatattattaaacattaa

DBGET integrated database retrieval system