KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06465Help
Entry
CGSHiEE_06465     CDS       T00543                                 

Definition
(GenBank) GTPase EngB
  KO
K07391  
magnesium chelatase family protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1282153..1283682
Genome map
AA seq 509 aa AA seqDB search
MSLAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY
PAKRITVNLAPADLPKEGGRFDLPIAIGILAASDQLDASRLKQFEFVAELALTGQLRGVH
GVIPAILAAQKSKRELIIAKQNANEASLVSDQNTYFAQTLLDVVQFLNGQEKLPLATEIV
KESAVNFSGKNTLDLTDIIGQQHAKRALTIAAAGQHNLLFLGPPGTGKTMLASRLTGLLP
EMTDLEAIETASVTSLVQNELNFHNWKQRPFRAPHHSASMPALVGGGTIPKPGEISLATN
GVLFLDELPEFERKVLDALRQPLESGEIIISRANAKIQFPARFQLVAAMNPSPTGHYTGT
HNRTSPQQIMRYLNRLSGPFLDRFDLSIEVPLLPQGSLQNTGDRGETSVQVREKVLKVRE
IQMERAGKINAYLNSKEIERDCKLNDKDAFFLEKALNKLGLSVRAYHRILKVSRTIADLQ
GEQQISQPHLAEALGYRAMDRLLQKLSNM
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttgctattgtttacagccgtgcttctatgggtgtgcaagcaccgctagtcacc
attgaggtgcatttaagcaacggaaaaccaggatttacacttgttggtttgccagaaaaa
accgtgaaagaggcacaagatcgggtgcgtagtgcgttgatgaatgcacaatttaaatac
ccagccaagcgtatcactgtaaatctcgcccctgcggatttaccgaaagaaggcggaaga
tttgatttgcctattgctatcgggattttagctgcatcagatcagcttgatgcaagccgt
ttaaagcaatttgaatttgtggcagagcttgcgctgacgggccaattgcgtggcgtacat
ggtgtgattcccgctattcttgcagcgcaaaagtcaaagcgagagttaattatcgcgaaa
caaaatgctaatgaagcctcgctcgtgtctgatcaaaatacttattttgctcaaacgctt
ttagatgtagtgcaatttctcaatggtcaggaaaaattacccctcgccactgaaattgtg
aaagaaagtgcggtaaatttttcaggtaaaaatacgttagatttaacggatattatcgga
caacagcacgctaaacgagcattgaccattgccgcagcggggcagcataatttgctcttt
cttggcccaccgggtacagggaaaaccatgttagccagccgtttgacagggcttttacct
gaaatgacagatctagaagcgatagaaacagcatctgtaacgagtttagttcaaaacgag
ttaaattttcataattggaagcaacgtccttttcgcgccccacatcatagtgcatcaatg
ccggctttagttggtggcggaacgatccctaaacctggcgaaatatccttagcaacaaat
ggggtgctttttcttgatgaacttccagaatttgagcgaaaagtgttagatgcactacgc
cagcctttggaaagtggtgagattattatttctcgtgccaatgcaaaaattcaattccca
gctcgttttcaattagtggcagcgatgaatccaagccctacaggccattatactgggaca
cataaccgcacttcaccacagcaaattatgcgttatttgaatcgactttcagggccattt
ttagatcgttttgatttatctattgaagtgcctttactgccacaaggtagcttgcaaaat
acgggcgatcgtggcgaaaccagcgtgcaagttcgtgaaaaagtgttaaaagtacgtgag
attcaaatggaaagagcggggaaaatcaacgcttatttgaacagtaaagagattgagcgt
gattgcaagttaaatgataaagatgcctttttccttgaaaaagcactgaataaacttggg
ctttctgtacgggcttatcatcgtattttgaaagtttctcgaaccattgccgatctacaa
ggagaacaacaaatttctcaaccgcacttggcggaggccttgggctatcgagcaatggat
cgtttgctgcagaaattgtcgaatatgtaa

DBGET integrated database retrieval system