KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06660Help
Entry
CGSHiEE_06660     CDS       T00543                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hip00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hip00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1317496..1318770
Genome map
AA seq 424 aa AA seqDB search
MDKFRVYGQSRLSGSVNISGAKNAALPILFAAILATEPVKLTNVPELKDIETTLNILRQL
GVIANRDETGAVLLDASNINHFTAPYELVKTMRASIWALAPLVARFHQGQVSLPGGCSIG
ARPVDLHISGLEKLGADIVLEEGYVKAQVSDRLVGTRIVIEKVSVGATLSIMMAATLAKG
TTVIENAAREPEIVDTADFLNKMGAKITGAGSDHITIEGVERLTGCEHSVVPDRIETGTF
LIAAAISGGRVVCQNTKADTLDAVIDKLREAGAQVDVTENSITLDMLGNRPKAVNIRTAP
HPGFPTDMQAQFTLLNMVAEGTSIITETIFENRFMHIPELIRMGGKAEIEGNTAVCHGVE
QLSGTEVIATDLRASISLVLAGCIATGETIVDRIYHIDRGYEHIEDKLRGLGAKIERFSG
SDEA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttcgtgtttatgggcaatctcgtttaagtggaagtgtgaatatttcaggc
gcaaaaaacgccgcacttccaattctttttgcggctattttagctacagaacctgttaaa
ttgacaaatgttcccgaacttaaagatattgaaacaactttaaatattttgcgtcaatta
ggcgtgattgcaaatcgtgatgaaactggtgcagttttattagatgcctctaatatcaat
catttcactgcaccttatgaattggttaaaactatgcgtgcttcaatttgggcattggca
cctttagtcgctcgtttccatcaaggtcaagtctcattacctggaggttgttctatcgga
gctagacctgttgatctccacattagcggtttagaaaaattaggtgcggacatcgttctt
gaagaaggatatgtaaaagcacaagtatcagatcgtcttgttggaactcgaattgtaata
gaaaaagtaagtgtaggcgcaactttatctattatgatggcagcaacccttgcgaaaggt
acgacagttattgaaaacgccgctcgtgaacctgaaattgtagatactgcagatttcctt
aataaaatgggtgcgaaaataacaggtgcaggttctgatcacattacgattgaaggtgtt
gaacgtttaactggttgtgagcacagtgttgtgccagatcgtattgaaacgggaacattc
ttaattgctgcagccatttcgggcggtcgtgttgtttgtcaaaatactaaagcggatact
ttagatgccgtaattgataaactccgtgaagctggtgcgcaagttgatgtaactgaaaat
agcattactttagatatgcttggtaatcgccctaaagcagtgaatattcgtactgcacca
catccagggttcccaactgatatgcaggctcaatttactttattaaatatggtggcagaa
ggtacaagcattatcactgaaacgatttttgaaaatcgttttatgcatattcctgaatta
attcgtatgggtggtaaagctgaaattgaagggaatacagcggtatgtcacggggttgaa
caattgtctggcacagaggtaatagcgacagatttacgcgcttcaatcagtttagtgctt
gcaggttgtatcgcaacgggagaaaccattgtagatcgtatttatcatatcgatcgtggt
tatgaacatatcgaagataaattacgtggtctaggtgcgaaaattgaacgtttttctgga
agtgatgaagcgtaa

DBGET integrated database retrieval system