KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_07055Help
Entry
CGSHiEE_07055     CDS       T00543                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:hip01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hip01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hip00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hip00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hip00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hip00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:hip00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1406366..1407331
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQLNRYSVSD
VINRGGTFLGSARFPEFKDPNIRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHSFP
CVGLPGTIDNDVAGTDYTIGYQTALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
SAGIAGGCEYIVASEIEFNREELIQQIERSIIRGKRHAIIAITELLTDVHSLAKEIEARV
GHETRATVLGHIQRGGSPCAFDRILASRMGAYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMQRVFKADWLKVAKRLE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgcagttttaacaagtggtggcgatgcgcctggtatgaatgccgca
attcgtggcgtagtacgttctgcacttgcagaaggcttagaagtatttggtatctatgac
ggttatcaaggtttatacaataataaaatcaaacaattaaatcgctatagcgtatctgat
gtgattaatcgtggcggtacttttttaggctctgcacgttttcctgaatttaaagatcct
aatattcgggcaaaatgtgcggaaattttacgttctcacggcattgatgcacttgtggtt
atcggtggtgacggttcttatatgggggcaaaattattaaccgaagaacacagtttccct
tgtgttggcttacccggtactattgataatgatgtggcaggtactgactataccatcggt
tatcaaaccgcattacaaactgcagtggatgcaatcgaccgtttacgtgatacatcaagc
tcacaccaacgtatttctatcgttgaaattatgggtcgccactgtagtgacttaaccatt
tctgcgggcattgctggcggttgtgaatatatcgtcgcatcagaaattgaatttaatcgc
gaagaattaattcaacaaattgaacgtagcattattcgcggtaaacgccatgcaattatt
gcaatcactgaacttttaaccgatgttcattctctggcaaaagaaattgaagctcgcgta
ggccacgaaactcgcgcaaccgttttagggcatattcaacgtggtggttctccttgtgct
tttgaccgtattcttgcctcacgtatgggcgcatacgcagtagatttattgctacaaggc
aagggcggctattgcgtaggtatccaaaatgaacaactcgttcatcacgatattattgat
gccattaataatatgcagcgtgtatttaaggctgattggcttaaagtggcaaaacgtttg
gaataa

DBGET integrated database retrieval system