KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_07165Help
Entry
CGSHiEE_07165     CDS       T00543                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CGSHiEE_07165
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CGSHiEE_07165
Enzymes [BR:hip01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CGSHiEE_07165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1426092..1427144
Genome map
AA seq 350 aa AA seqDB search
MSTLLIDLKGKELEQEEVELLSHPLVAGLILFTRNFEDREQIQELIRSVRQRVKKPLLIT
VDQEGGRVQRFRDGFTMLPSMQAFQETLSATEQVSFAKEAGWQMAAEMIALDIDLSFAPV
LDLGHECRAIGDRSFSSDVKSAVNLAINFIDGMHQAGMASTGKHFPGHGHVLADSHLETP
YDDRTKDEIFGCDLQPFQQLIAQNKLDAIMPAHVIYSQCDSQPASGSEYWLKEILRKKLN
FQGTIFSDDLGMKGAGVMGNFVERSKKALNAGCDLLLLCNEREGVIQVVDNLKLAKNQPH
FMARQARLQNLFKRRVIDWNDLVSDLRWKLNYRNLADIQIRWLDIQAAKK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttgttaattgatttaaaaggaaaagagttggaacaagaggaagttgagtta
ctttcgcaccctcttgttgcaggattgattttatttactcgaaattttgaagacagagaa
caaattcaagaattaattcgttctgttcgccaacgagtaaaaaagcctttattaattaca
gtggatcaagaaggtggacgagttcaacgttttcgtgatggatttacaatgttgccttca
atgcaggcttttcaagaaacactatcagcaactgaacaagtaagttttgctaaagaagca
ggttggcaaatggcagcagaaatgattgctttggatattgacttgagttttgcaccagtg
ctggatttggggcatgaatgtcgagcgattggtgatcgcagtttttcatctgatgtaaaa
agtgcggtaaatttagccatcaattttattgatggtatgcatcaagcaggtatggcatct
acaggtaaacattttcccggtcatggtcatgtattagccgattctcacttagaaacacct
tatgatgatcgcacaaaagacgaaatttttggttgcgatctccaacctttccagcaattg
attgcacaaaataaacttgatgcgattatgcctgctcacgtgatttattcgcaatgtgat
agtcagcctgcaagtggttcagaatattggttgaaagaaattttacgcaagaaattaaat
ttccaaggtacaattttttccgatgatctaggaatgaaaggcgcgggagtaatggggaat
tttgtagagcgtagtaaaaaagcactcaatgcaggttgtgatcttttgttattgtgcaat
gaacgagagggcgtaattcaagtggtggataacctaaaactggctaaaaatcaaccgcac
tttatggctcgtcaagctcgcttacaaaatttatttaaacgtagagtgatcgattggaat
gatctggtttcagatctacgttggaaactgaattaccgaaatctcgcagatattcaaatc
cgttggctagatattcaggctgcaaaaaaatga

DBGET integrated database retrieval system