KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_07165Help
Entry
CGSHiEE_07165     CDS       T00543                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hip00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:hip00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1426092..1427144
Genome map
AA seq 350 aa AA seqDB search
MSTLLIDLKGKELEQEEVELLSHPLVAGLILFTRNFEDREQIQELIRSVRQRVKKPLLIT
VDQEGGRVQRFRDGFTMLPSMQAFQETLSATEQVSFAKEAGWQMAAEMIALDIDLSFAPV
LDLGHECRAIGDRSFSSDVKSAVNLAINFIDGMHQAGMASTGKHFPGHGHVLADSHLETP
YDDRTKDEIFGCDLQPFQQLIAQNKLDAIMPAHVIYSQCDSQPASGSEYWLKEILRKKLN
FQGTIFSDDLGMKGAGVMGNFVERSKKALNAGCDLLLLCNEREGVIQVVDNLKLAKNQPH
FMARQARLQNLFKRRVIDWNDLVSDLRWKLNYRNLADIQIRWLDIQAAKK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttgttaattgatttaaaaggaaaagagttggaacaagaggaagttgagtta
ctttcgcaccctcttgttgcaggattgattttatttactcgaaattttgaagacagagaa
caaattcaagaattaattcgttctgttcgccaacgagtaaaaaagcctttattaattaca
gtggatcaagaaggtggacgagttcaacgttttcgtgatggatttacaatgttgccttca
atgcaggcttttcaagaaacactatcagcaactgaacaagtaagttttgctaaagaagca
ggttggcaaatggcagcagaaatgattgctttggatattgacttgagttttgcaccagtg
ctggatttggggcatgaatgtcgagcgattggtgatcgcagtttttcatctgatgtaaaa
agtgcggtaaatttagccatcaattttattgatggtatgcatcaagcaggtatggcatct
acaggtaaacattttcccggtcatggtcatgtattagccgattctcacttagaaacacct
tatgatgatcgcacaaaagacgaaatttttggttgcgatctccaacctttccagcaattg
attgcacaaaataaacttgatgcgattatgcctgctcacgtgatttattcgcaatgtgat
agtcagcctgcaagtggttcagaatattggttgaaagaaattttacgcaagaaattaaat
ttccaaggtacaattttttccgatgatctaggaatgaaaggcgcgggagtaatggggaat
tttgtagagcgtagtaaaaaagcactcaatgcaggttgtgatcttttgttattgtgcaat
gaacgagagggcgtaattcaagtggtggataacctaaaactggctaaaaatcaaccgcac
tttatggctcgtcaagctcgcttacaaaatttatttaaacgtagagtgatcgattggaat
gatctggtttcagatctacgttggaaactgaattaccgaaatctcgcagatattcaaatc
cgttggctagatattcaggctgcaaaaaaatga

DBGET integrated database retrieval system