KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_07235Help
Entry
CGSHiEE_07235     CDS       T00543                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:hip03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1437715..1438530
Genome map
AA seq 271 aa AA seqDB search
MPELPEVETALRGISPYLKNFTIEKVVVRQPKLRWAVSEELITLKNVKIVDLTRRAKYLI
IHTEKGYIIGHLGMSGSVRIVPQNSAIDKHDHIDIVMNNGKLLRYNDPRRFGAWLWTENL
DDFHLFLKLGPEPLSDEFNAEYLFKKSRQKSTALKTFLMDNAVVVGVGNIYANESLFICG
IHPLKLAKNLTLNQCFSLVNTIKDVLRKAIIQGGTTLKDFLQPDGRPGYFAQELLVYGNK
DKPCPKCGGKIESLIIGQRNSFFCPKCQKRG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacttcctgaagtcgaaactgcactacgtggtattagcccttatcttaagaat
tttacgattgagaaagttgtcgtgcgccagcctaaattgcgctgggctgtatcagaagaa
ttaataacccttaaaaatgtaaaaattgtcgatctcactcgtcgagcaaaatatttgatt
attcacacggaaaaaggctatatcatcgggcatttgggcatgtccggttcggtgcgaatt
gtgccacagaatagcgcaatagataaacatgatcatattgatattgtaatgaataatggc
aagttattacgctataacgatcctcgccgtttcggtgcttggttgtggacggagaatcta
gatgactttcatcttttcttaaagttaggccctgaaccactttctgatgaatttaatgcc
gaatatttattcaaaaaatctcgtcaaaaatctaccgcacttaaaactttcttgatggat
aacgctgtggttgttggtgttggaaatatttatgcgaatgaaagtttgtttatttgtggc
attcatccccttaaactcgctaaaaatttgactctcaatcaatgtttctctttagtgaac
acgattaaagatgttttgagaaaagccattattcaaggtggaacaacacttaaagatttt
ttacagcccgatggtcgcccaggttattttgcacaagaattattggtatatggcaataaa
gataaaccttgtccaaagtgcggtggaaaaattgaaagtttaattattggacagcgtaat
agtttcttttgcccgaaatgtcagaaaaggggttag

DBGET integrated database retrieval system