KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_07515Help
Entry
CGSHiEE_07515     CDS       T00543                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CGSHiEE_07515
   00670 One carbon pool by folate
    CGSHiEE_07515
Enzymes [BR:hip01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CGSHiEE_07515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1491447..1491929
Genome map
AA seq 160 aa AA seqDB search
MTFSLIVATTLNNVIGKDNQMPWHLPADLAWFRQNTTGKPVIMGRKTFESIGRPLPKRTN
IVLSRQLFEHDGVVWKGSLESAVDFVRDFDEIMLIGGGELFKQYLPKADKLYLTQIQTEL
DGDTFFPQLNWEEWEIEFDEYRKADEQNRYDCRFLILTRK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacatttagtttaattgtggcgacaacattaaataatgtgattggtaaagataaccaa
atgccttggcatttgcctgcagatttagcttggtttcgtcagaacaccactggtaaacct
gtcattatggggcgtaaaacctttgaaagcattggtcgtccactacctaaacgtaccaat
atcgtactttctcgccagctttttgaacacgacggtgtggtatggaaaggtagccttgaa
agtgcggtcgattttgtcagagattttgatgaaattatgctgattggtgggggagagtta
ttcaaacaatatttgcccaaagcagataagttataccttactcaaattcaaacagaacta
gatggcgatacttttttccctcaattgaattgggaggagtgggaaattgaatttgatgaa
tatcgtaaggcagatgaacaaaatcgctatgattgccgatttttaattcttactcgaaaa
taa

DBGET integrated database retrieval system