KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_08000Help
Entry
CGSHiEE_08000     CDS       T00543                                 

Definition
(GenBank) carbon storage regulator
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00040  Pentose and glucuronate interconversions
hip00052  Galactose metabolism
hip00500  Starch and sucrose metabolism
hip00520  Amino sugar and nucleotide sugar metabolism
hip01100  Metabolic pathways
hip01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CGSHiEE_08000
   00052 Galactose metabolism
    CGSHiEE_08000
   00500 Starch and sucrose metabolism
    CGSHiEE_08000
   00520 Amino sugar and nucleotide sugar metabolism
    CGSHiEE_08000
Enzymes [BR:hip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CGSHiEE_08000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 CoA_binding
Motif
Other DBs
NCBI-ProteinID: ABQ98913
Position
1586364..1587251
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEIRSICPKNVTIMHVRQGNAKGLGHAVLCGRPLVGN
EPFAVMLPDVLLAEFSADQKKENLAAMIQRFNETGASQIMVTPVPQENVSSYGVADCGGI
ELNGGESAKINSIVEKPSIEDAPSNLAVVGRYVFSAAIWDLLEKTPIGVGDEIQLTDAID
MLIEKETVEAFHMTGETFDCGDKIGYMEAFVEYGIRHEKLGKEFKTFIKNLAKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattattcctgtcgccggtcttggcacacgtatgttgcccgccacgaaggcg
attccgaaggaaatgctcactttggtggataaaccgttaattcaatacgtggtaaatgaa
tgtgtagctgctggcataaaagaaattgtgctggtaacacattcatcaaaaaatgctatc
gaaaaccattttgatacatcttttgaattagaaacgatgctggaaaaacgtgtgaagcgt
cagcttctagaagaaattcgttctatctgtccaaaaaatgtaacgattatgcacgttcgt
caaggtaatgcgaaaggcctaggtcacgccgtgttatgtggtcgtcctttagtaggaaat
gaaccttttgccgttatgttaccagatgtattattagctgaatttagtgcagatcagaaa
aaagaaaatcttgctgcaatgattcaacgctttaatgaaactggcgcaagccaaattatg
gtaaccccagttccgcaagaaaatgtgagtagctatggtgttgcagattgtggtggcatt
gagcttaatggcggcgaaagtgcaaaaattaatagtattgttgaaaaaccttctattgaa
gacgcaccatcaaatcttgcagtggttgggcgttatgttttttcagcagcaatttgggac
ttgttggaaaaaacaccaattggtgttggcgatgaaatccaattaaccgatgctattgat
atgctaattgaaaaagaaaccgttgaagcatttcatatgacaggggaaacttttgattgt
ggtgataaaattggttatatggaagctttcgtagaatacggtattcgtcacgaaaaatta
ggtaaagaattcaaaacctttatcaaaaatttggcaaaaacgctataa

DBGET integrated database retrieval system