KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_08000Help
Entry
CGSHiEE_08000     CDS       T00543                                 

Definition
carbon storage regulator
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CGSHiEE_08000
   00052 Galactose metabolism
    CGSHiEE_08000
   00500 Starch and sucrose metabolism
    CGSHiEE_08000
   00520 Amino sugar and nucleotide sugar metabolism
    CGSHiEE_08000
Enzymes [BR:hip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CGSHiEE_08000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1586364..1587251
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEIRSICPKNVTIMHVRQGNAKGLGHAVLCGRPLVGN
EPFAVMLPDVLLAEFSADQKKENLAAMIQRFNETGASQIMVTPVPQENVSSYGVADCGGI
ELNGGESAKINSIVEKPSIEDAPSNLAVVGRYVFSAAIWDLLEKTPIGVGDEIQLTDAID
MLIEKETVEAFHMTGETFDCGDKIGYMEAFVEYGIRHEKLGKEFKTFIKNLAKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattattcctgtcgccggtcttggcacacgtatgttgcccgccacgaaggcg
attccgaaggaaatgctcactttggtggataaaccgttaattcaatacgtggtaaatgaa
tgtgtagctgctggcataaaagaaattgtgctggtaacacattcatcaaaaaatgctatc
gaaaaccattttgatacatcttttgaattagaaacgatgctggaaaaacgtgtgaagcgt
cagcttctagaagaaattcgttctatctgtccaaaaaatgtaacgattatgcacgttcgt
caaggtaatgcgaaaggcctaggtcacgccgtgttatgtggtcgtcctttagtaggaaat
gaaccttttgccgttatgttaccagatgtattattagctgaatttagtgcagatcagaaa
aaagaaaatcttgctgcaatgattcaacgctttaatgaaactggcgcaagccaaattatg
gtaaccccagttccgcaagaaaatgtgagtagctatggtgttgcagattgtggtggcatt
gagcttaatggcggcgaaagtgcaaaaattaatagtattgttgaaaaaccttctattgaa
gacgcaccatcaaatcttgcagtggttgggcgttatgttttttcagcagcaatttgggac
ttgttggaaaaaacaccaattggtgttggcgatgaaatccaattaaccgatgctattgat
atgctaattgaaaaagaaaccgttgaagcatttcatatgacaggggaaacttttgattgt
ggtgataaaattggttatatggaagctttcgtagaatacggtattcgtcacgaaaaatta
ggtaaagaattcaaaacctttatcaaaaatttggcaaaaacgctataa

  All links  
No link information was found.   
DBGET integrated database retrieval system